SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.B1N2G0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.B1N2G0
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily POZ domain 1.91e-30
Family BTB/POZ domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.B1N2G0
Sequence length 98
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MDIPNLKLISQDGHEFYISRECAQHSGTLKTMLEDQPTEGIITIPIPGIPSKLLERTIEY
MYYRQMYSRAPSQDVIPNFDIDPSNALELLLASHYLDL
Download sequence
Identical sequences A0A175JDJ5 B1N2G0 K2H7R5 M2RQZ3 N9T9B5
gi|169803167|gb|EDS89855.1| gi|183229719|ref|XP_001913358.1| XP_001913358.1.49425 XP_008855024.1.50645 jCVI|EHI_152700 294381.B1N2G0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]