SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.B1N2H9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.B1N2H9
Domain Number 1 Region: 17-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.72e-28
Family Calponin-homology domain, CH-domain 0.00099
Further Details:      
 
Weak hits

Sequence:  294381.B1N2H9
Domain Number - Region: 644-749
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00811
Family Myosin rod fragments 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.B1N2H9
Sequence length 811
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MLSEHQRLRKSASVKIQKVVQEQHSKAYKDWLNFINQDEPHVNDIFTDLRSGLALIKLME
KLTGKTLDKKYDKNPKDVIHERDNIELLIGFMKRNKVDVRIVAQDIFDQNKKQILQLFNT
LVRKYHYKEHNLHPNDFNKWLSTIFGREVYVEKEYMDEHFWEKLINYFRVDSVLEKEFTN
DPKANMNYCFTAARDFLGIPIIMEPSLVASGFLDDEVLTMYLVYYVLNDKNIRDDEEIKF
LQNDIISVSSPSQLSRSTRARPKTMNLTMAGSRLSEKLDLEDYEELNLEDMKGDETKTES
EGEKGLVEEFSNRRDNFNKMGETELELRRMKEENERIKKALKSKQNECAEMTKKVGELND
SITQKEKSYIQMRDEREKIEEDLNEKLHNMFIELKGVKEEREKLINENTEKGNKINLLNK
TMDNLQQEKKQTKKSFDEQINFMEGRINTIQNRCETQVNDERLINETLKKSNNAFILHNA
ELTSTNELLKKENEELKKENNKITEELSQVKSSTIGEKEEINIIKKEKSELEEIIKQLKK
ENEELKTENENNKKEIKELTLNIQEIQTLLNKTQTENSTKISELEEKLKDSQKELGEIQI
NLNQEKEINNKLNEQISKCNKEIQSLNDKNIELEKLISTLQQEIENNKKEVENSKKEVED
MKYELEHYKSDDNDREHQLVDLQTEVTQLKYEIQSFILKQQKADEQIKDLENQISNLQKE
KEDILHSLEVDKQNRIKIEEESQKTIAEFKKNVELFGVLDEDDRKSLFISXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXYKISLCY
Download sequence
Identical sequences B1N2H9
XP_001913395.1.49425 294381.B1N2H9 jCVI|EHI_011660 gi|169803036|gb|EDS89820.1| gi|183230018|ref|XP_001913395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]