SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.B1N341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.B1N341
Domain Number 1 Region: 8-241
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-56
Family Calponin-homology domain, CH-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.B1N341
Sequence length 560
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MSQQQGNNKEAGWVRVQIQLFTLWMDEVLQQRQMGVKDLAVDLKDGIRVINFFELLSGKT
LKEKYDLRPKNRIQMVHNLHLAMQFLEKEMLVRNPGCFAEDVVDADIHGVKLILGLLYTL
YRKYRLSVLVDKKKGKSMKEEDALLEWVKEVTDGYGVTVENFKHSFNDGKVYLALAHVIS
NKSFDYDEFKDKSRTEILEKAFSVAEENGIHRLLMVDEVANGDIDERALVLYTSLYHHEY
LKRKEMEALQGDVEKNQAQLELEAKSKDDLIKLNVELKTQHETLTNELNDMEKQLVEKRL
VLTDLQKKGVELDQTLVEKKESFGKIDLEKNDSEVNLKAAEVLFNQLTEKYENFTAVGED
DKEEINDLTKEIEEIRKMVEERKKQLAEMKEKEGESMASKFVEENKRSAELGDKKTDLVE
EIEELEEEVSVLKKTVQTAQDDCDEDKKDLEKAGELQKLYLNIQPLEENLRRQIVDLHKW
APYLKSEEGFGQEDPKLKTLNEPKEGDYKEVFKEMAEDLEKENDEVGKILVQLKKEQLQK
EQKKTAKVGVKKPVVKKDKK
Download sequence
Identical sequences A0A175JL41 B1N341 M2S9L7 M7VZH9
gi|169802382|gb|EDS89617.1| gi|183231674|ref|XP_001913607.1| 294381.B1N341 jCVI|EHI_104560 XP_001913607.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]