SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.B1N401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.B1N401
Domain Number 1 Region: 81-155
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.63e-26
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 7-68
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000173
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.B1N401
Sequence length 160
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MAETGSMVTLVSCDNENFQVEKAIAQEIGAVRNLLEDFQTEKIIPLTQVNKETLKKMIDF
ISHHHQYPFLGGNESEKKGQLTSWDYSFFDLDQQKLFELIIAANNLDVQVLLELGCKYIA
EMIKGKSVEELRSTFGIINDFTKEEEAEIKQKNKWLEEFV
Download sequence
Identical sequences A0A175JTY1 B1N401 M2RXU1 M3UM22 M7W6D3 N9UVB8
XP_001913917.1.49425 gi|169801404|gb|EDS89308.1| gi|183233796|ref|XP_001913917.1| jCVI|EHI_065310 294381.B1N401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]