SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.B1N493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.B1N493
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000589
Family p120GAP domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.B1N493
Sequence length 162
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MNEIVEEKIPSKVDFDKLLFSRRHNLLEAVVRTLVTQQRQNRSAEYARIISDYFKAHGRF
MELITWAIDIDFLSTDTLMIDSSSFQYSTFFIPFYNQFVRYYFKNYLLDTFEPIIDGLIL
GGDYSEEFKIAMNFQSKEITTSEDIAAYQQSLDTISKIFCKL
Download sequence
Identical sequences B1N493
gi|169801123|gb|EDS89214.1| gi|183234373|ref|XP_001914009.1| jCVI|EHI_185440 XP_001914009.1.49425 294381.B1N493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]