SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LS94 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LS94
Domain Number 1 Region: 41-270
Classification Level Classification E-value
Superfamily VPS9 domain 0.00000000222
Family VPS9 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LS94
Sequence length 272
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MQKTAKEVDDHLKKIIKIYLKDNKQKELIEEVFESIADCPSHPLLDVIECSIQALMANIS
RIGILKKSENSQIAAHIKTLIAQTASELKEQIANHFHIKKSDELTPFIEDILFELCFDSV
KDIFIKKEEKNDERYELQVLKLGSQNLGHILHLEPPKYPKDSLDIVFDRSLKTIKMLEDV
TTLIKARELIVKLHKTIIDDMAKYNNGQTPIDFATDDFINVIIFLILRSHVKNPFGMTSL
LDGFMTNNDDCSEFGFSMFNLQIGVKTIINKL
Download sequence
Identical sequences A0A175JDJ9 C4LS94 M3SD05 N9V6A8
gi|56472868|gb|EAL50326.1| gi|67480725|ref|XP_655712.1| XP_655712.1.49425 jCVI|EHI_153010 294381.C4LS94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]