SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LSN9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LSN9
Domain Number 1 Region: 20-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-32
Family Lectin leg-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LSN9
Sequence length 484
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MIILIILLALLSSSKMVVDVLSFREPIEPENVVRNYDMKGPIIVFENYVQITPNGIGKSS
IMNGKYKVDLPSFELQLKLNIICKEKCGGGMGVWLTEEKLKEGDLFGAYNIYKGIGIFIN
FEDVDIPMISVLKNDGVDILKYKPEMYYQCSVANIQKDKDGAVLRIKYLVNEKKLIIEIM
VNHINMDCITIEDIDIPPFYLGISATNGGSGSTSYRVQSLHYYEVGNKERKEVHLNNVVE
NEQINDTPETKAEQASNRIKERKQNNINKEKQRENERIENLQKLEEANKRLNENDHLTEE
NKKEETQNIKLNNSLNEEEEMKEQITIEEDKKQEEIKDQQIIEEQKKQEEIVQKQEHMKE
LKRIRIQDGLYKIYKAIAPMKNALDKVAQVKKDDELLKLFDGIVVDENNKAKNQLKEILD
QIELGKVSNNVFGVRSDLVQVKVLFSGVQQSSWKIVWIVLLISLILAAYFAFKLSMVKKI
NHYD
Download sequence
Identical sequences A0A175JCQ1 C4LSN9 M2S5L5 M3SB96 M7WGX7 N9T8S1
XP_657380.1.49425 294381.C4LSN9 gi|56474634|gb|EAL51996.1| gi|67484320|ref|XP_657380.1| jCVI|EHI_152000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]