SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LVT1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LVT1
Domain Number 1 Region: 123-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000253
Family SPRY domain 0.066
Further Details:      
 
Weak hits

Sequence:  294381.C4LVT1
Domain Number - Region: 79-129
Classification Level Classification E-value
Superfamily BC4932-like 0.0706
Family BC4932-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LVT1
Sequence length 327
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MSSINEDTIKSILKEMNEMKNEINSLKEKVSSLEHKIELKEALDFIKQKIGLEQGTNVEL
YGVTVEDLLEGELTCVSNFHDGTPSKNTYNNTALTTKKGKKKEIRCVSSTNLDREGKIQM
LWKDNNTVVLCPSLVHYYEVSIKGKSEYCWISVGLSSTKTMIRNHQIGWDKRTIGIHSDD
GKVFNENGKVGLNCTTSFGPGDVIGCGWNSTNKTVFFTRNGEMLDTFNYPHTVLNFGIGM
KDFEKIEINTGEREPFEFDLCSFVEDLVAHHCQKQNYDDSIEEDENSSNVTFSSEEQNEQ
KVKEIKKPLKTNHKRDHCDCCECKHHH
Download sequence
Identical sequences A0A175JGR0 C4LVT1 M2SAE2 M3SD45 M7VSK0 N9V3K8
gi|56473673|gb|EAL51088.1| gi|67482245|ref|XP_656472.1| jCVI|EHI_187140 294381.C4LVT1 XP_656472.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]