SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LX13 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LX13
Domain Number 1 Region: 202-401
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-43
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 11-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-23
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 3 Region: 677-749
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 3.4e-16
Family VHP, Villin headpiece domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LX13
Sequence length 749
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MESDDQFIQFIQKKMVLISWMETILKVPINPDLCNSLKSGTILCYLAKTIDDDLIPVIHD
SKHPYKQLENLNMFLQVCKEMHVPLLRIATHDDFVKGNIVRIVECVFLFATECFKIYNIE
PFPQIPIEEVKKNLPSGQEAENIKEQLKYIQRTVIGGKIRVSASVFRTTLQFLMSTTKGF
DMNVFEGTIAKAQAYFRRFSAKNEMNSLKKKNAFRIKVTQEMVKTEDDYVHYLKEGIDKY
RPIIQSFVENGALKKDSVQIIFNNMEEIYQFNSKFLNDLKKATEDMKPNKPWINVYKELE
GALSVYTPYLVNYSESIERVEQILCIECVRDALMKEKGNDKDMSSYLIMPIQRLPRYVLL
LNELKKHTWNDHPDANNLVEMVSLIKKVTTTIDETKTKADSERVKPKLFDKFKPGKFGDI
TNEEILYITDFKLKGCPVSAILTQNLLAISNKENLIRFVFPISRITLLPCNSKKDSIKIR
VRTKSKIKLQGTKLVPDGGLIRMVNDLKKLQSASVPNFPLTESCVVHRTTELHSGDIDRS
IDPEEELMKRRKDKGGRMSIYSKRPIALTNDQLPFNSSLLKVPMEKKNRCSEIPTDNIKS
IEEYKNDRQSECSRKGSVSGTDSPSSFKPKLTISVNNSKGDASKRDRRSLCAEITLKVSK
HGGNNDLTKNMLREKNVQLVDGKRTLNSLGLEVYSFRELENKPDGIAKDDLVFHLSDEDF
IELFDVTFDMFKSWKQWKQQTEKQKAGLW
Download sequence
Identical sequences A0A175JI61 C4LX13 M2Q5L5 M3UNV8 N9V8A7
294381.C4LX13 jCVI|EHI_127420 gi|56469148|gb|EAL46929.1| gi|67473068|ref|XP_652315.1| XP_652315.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]