SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LY04 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LY04
Domain Number 1 Region: 382-588
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-43
Family DBL homology domain (DH-domain) 0.00034
Further Details:      
 
Domain Number 2 Region: 925-1037
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.53e-18
Family Pyk2-associated protein beta ARF-GAP domain 0.01
Further Details:      
 
Domain Number 3 Region: 808-892
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000108
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 612-698
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000162
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 5 Region: 3-89
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000428
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LY04
Sequence length 1045
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MEKYIDWVNEHITNPSLYISSIQDIREGHALLAIMKQITHTNVKTDTPLQTALQLAEKHF
GKLEGLNIQKIEKGDEKQIIALIGFLMKKEKSTMRKLSDTIYKSEIMNQSFRRRAFTVKK
DGKKVEVVRNEPIVSAFVENNESVQPKITARPIRHNVKPLNLKPIIQEETNEEKQKEPEI
NGSQELIFPEPSQITKTEIPPTPTKEVTPELITSERKERREKKRQQIEKEKEKLRKMEES
RKERTMKKEELKRMKEQMIIEHSNSPQKDVDTSLLTSPEPEIEKEEAIEEVFRGVFMLEG
NYYIVNEEGDGGELVEYVCEHYNEMVTSCARSLIVSYQYNEEIKRQQEKMKALDARVTQE
HINSIVAIQTKIRCRNARHLPEIRGMKERKNLVKELIESEHKYVDNLKILKEYYLEKILE
EREDKTIRNCFKNLEMIVKYNVILLKDLDDMSKNCVYGEGVSSVFKKFTGFLKCYTVYVN
SYDTTNDYFVTLNSKNKRFMDLLKKLSLQKEVKNLNIFSYLILPIQRVPRYELFIRGVLK
VLPRTHKEYKGLQDLMNEIKKIGDYLNERRRESENKQLLMKFKHHLEIKKFDLMDDDKRR
LVKYGAIQSKEYGPLIIFLLSDVLLVHRAKQEVKDVDALLEKNKLKIKDIIPLFGIGIYS
EGDNTFSVVSKKMIFTFIAENEEEKGDWMMAFDDILSREHNSAMSRLNTIRQSETVKSNK
VDDIFYQGYLKMSLKMFEKYVGGIVSFNTNVDLTKKRLDGSPNIDKKNSPMQTPRKVAAT
QVLLSPRLNSSFRSPRSVRINNDHEEEKDRYCVIDGEELIVYNSVKDSLKKANWHMKVIL
SGVSVEAVVAINNPAAFQINISGKTTFVTAPSSEDKWKWLTVFRDAFYRSAKDKLIELKI
LQPKQDIVFCYPPPPLFIAERGQFSNYLDMVLSIPTNSVCADCGDHKIVCADTTYGVFLC
RDCSNCHKNQLKSDIIFIKNLYIKNSFYEIRIFKERGNLLMNELADMKSPDIVSKQNKAD
LLNSLSLRQEFLPLKYKDLPKYQLI
Download sequence
Identical sequences A0A175JJL7 C4LY04 M2Q6K0 M3TFK7 M7W0F6 N9UZA7
gi|56473331|gb|EAL50765.1| gi|67481603|ref|XP_656151.1| jCVI|EHI_035770 294381.C4LY04 XP_656151.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]