SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LY92 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LY92
Domain Number 1 Region: 12-76
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000000068
Family SNARE fusion complex 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LY92
Sequence length 84
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MFPTVVRSPYFENQKDRIKKQLEETRNTMAKNVEMMTQNIATAEELEVQSNEMSINAQQF
KKQAIVLRKTYWWKNFKVCFFFFS
Download sequence
Identical sequences A0A175JK20 C4LY92 M2RZQ4
294381.C4LY92 gi|169802470|gb|EAL45138.2| gi|183231448|ref|XP_650520.2| XP_650520.2.49425 jCVI|EHI_166880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]