SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LZ78 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LZ78
Domain Number 1 Region: 80-115
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000628
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  294381.C4LZ78
Domain Number - Region: 165-183
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00916
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LZ78
Sequence length 184
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MNSIGSSIEVETLEVCTQFKSVELINHLEGNGLIHIETKEKELPNHFIADNNYDKTKSQS
KEEDTIKREEWLYYRGIYQKRLKDRELFKRRCKRCGEFGHLPKECKNEPKFKEDIIKEIE
TTRGKQTFRINCYSKKTINQQKYEHHRQLPIQKFQKLKVPINCRYYCDYCREYGHKTFNC
PHKY
Download sequence
Identical sequences A0A175JL16 C4LZ78 M2RRR2 M3S4G4 M7WE54 N9TEX2
jCVI|EHI_104690 gi|56467222|gb|EAL45195.1| gi|67469179|ref|XP_650581.1| 294381.C4LZ78 XP_650581.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]