SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LZG6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LZG6
Domain Number 1 Region: 145-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000214
Family Legume lectins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LZG6
Sequence length 266
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MEKQTNNLGKIINTLNQKIEDLSYLIQIQNIEFTKELRKRDEKINSLEKEIQYIKQLKCI
EEGIKEDNDYAPIIANKLHINKMIVKEKETKWKEIFEEFVLKEYVSTVLIPNKNGVLISS
KKWNKEKKPIMINNLSHVLLIVTNHQYFEISIQSAPPKLISFGVVSSLTYKEKVPIGQEK
ESIGFDSNGTLLLANGLKKKIARAWKSNDVVGCGYDAQESNVYFTLNGKKIIQVSTVFSD
WYPAIQPSGFTQFTTNFGETPFVKSF
Download sequence
Identical sequences A0A175JLB7 C4LZG6 M3S7H9 N9V6J5
jCVI|EHI_138060 gi|56473078|gb|EAL50524.1| gi|67481117|ref|XP_655908.1| 294381.C4LZG6 XP_655908.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]