SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LZX4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LZX4
Domain Number 1 Region: 309-515
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.01e-37
Family DBL homology domain (DH-domain) 0.00086
Further Details:      
 
Domain Number 2 Region: 3-128
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-20
Family Calponin-homology domain, CH-domain 0.0057
Further Details:      
 
Domain Number 3 Region: 801-912
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-19
Family Pyk2-associated protein beta ARF-GAP domain 0.021
Further Details:      
 
Domain Number 4 Region: 504-656
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000217
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LZX4
Sequence length 997
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MNYKEEEYKDCIEWINKQLEDDPITDLLSGLQNGIKLIKIVEKLTHKSAVRYNSNPKNIF
QIQQNMDVLLKMIKENYGEPIGSDATLLANGEIQQFLSLIFFIGQKSGTKIQKRRTLGRN
TMNRVIQYQSRLQNETEPFTKKIHNIQEQEQTKEIQHEKQITPKKENKPCQTEEVKGIET
KKKYSKTRKTQSENLSIIKETNTEEEIKSSIIKESKELNQKITSEQKDDEILLQPPKVPE
KPKKLQHKIHTENESNNDEKINEINQKIEENQIFKSESSKEKKWIEKEYDINLVKNIQRR
IYGFLSRKSSKSTMKLLVQRKNVVKELIKTEEVYVNKLQQFLDLYLKTALTIYPTDKILK
KCEEDVIVILGYNKMMYQRVLEVQKKVFYYGQGIGSVFQKLAHFLKTYCSYVNSTDAINE
HEEKLRKTNKQFDYALNEIRRINNLDTFNSYVILPVQRIPRYRLLLQELLKTLPPQHSEY
NSLNNSLQAIADIGIVMNESKRTLEIQQLIGKLTNKFKYSQGINPIEPNASRKFIRFGLI
TIYEPEAKTKYRSVYLFLFNDTVILTKINSAGTSHKGKIFTETIQTICESKKQLTVELVI
PIGSFCVLDSIKIESSPTFLIVNKSGKTIYFICLNEEEKMGWVVDLDNQISQIQEQSLLT
ISHSNNSLPSFYEEYKNQLSENTIRDIWWKGPIGSDGKYMILGNGFLCTFSNEEDAFKRI
RVNDYFVTKYTSVAFIPPSSISLINYGTYDKTKSVFDMCCTSLALLWVFYIRQSFIGSYD
FEETHLDLFDGIDSDIAGLTVKNIMLGLESIPSNRVCADCGSTDLRYVDLNYGCFLCCAC
GRAHTLFPTIRNTSNICTIDKTSEYQVSEIKKLIQFGNGFGNILRLTGKEIPKSSVEYEE
ANKYQYYWIKYGIEGDAPKCIKSDLKKKQISSEFKRVTVSQTTNNQPSIDTSTIPITELN
KEKRNTISSISQTPITQQPTEKIKRKEGEKKRKKSFY
Download sequence
Identical sequences A0A175JLP1 C4LZX4 M2RXX6 M3TGQ7 M7WQV8 N9V944
XP_654726.1.49425 gi|56471797|gb|EAL49340.1| gi|67478688|ref|XP_654726.1| 294381.C4LZX4 jCVI|EHI_194630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]