SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M003
Domain Number 1 Region: 102-193
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.01e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M003
Sequence length 197
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MAAKPEFQEIKQQQIHNEEELREIHVPGQRFNYVKENWIGIYQPIVSQLKLNIRMNPSKK
LIQLKTNDKSQLDSLQKASDFINAIGKGFEVKDAIALLRMDDIFVDSFEIEDVKKLHGDH
LNRAIGRIAGKDGKTKFSIENTTHTRIVMQYKKIHIMGSYANIKIARDAIQDLILGAPPG
KVYNNLRTIASRMDSAL
Download sequence
Identical sequences C4M003 K2HC02 M2RVZ7 M3SF73 M7WU00 N9UVC5
gi|56470639|gb|EAL48278.1| gi|67476122|ref|XP_653664.1| XP_008857485.1.50645 XP_653664.1.49425 294381.C4M003 jCVI|EHI_065870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]