SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M0Z7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M0Z7
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000737
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M0Z7
Sequence length 287
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MHLTINYQNKEYPITVEETEIVANLKNEIDNLINISIDRLELKCNGIVLDCNSHTLNSYK
VTDHCKIEVTILPPQLHSSLLFPSNAIYSICAILLVYFSTHPSIPSLEETTESTAMISCI
ILIVYLVFKSLFSLFLDYPAKPTVGLARAMFTAITGVLICAMLSFELCYRKNETSTLCTI
IGAINCMSCTMGLYYHHTYLSKGYNAFGELAYFPSKALYSFISCPNNLFEGLFFTSFMFC
TSFTKTSIILCILNWVAMVMLSQRQHNAYKKTFKNFPIRYRFIPFIW
Download sequence
Identical sequences A0A175JMX6 C4M0Z7 M2QGZ4 M3TU54 M7W9E8 N9UKG3
gi|56468424|gb|EAL46270.1| gi|67471409|ref|XP_651656.1| XP_651656.1.49425 jCVI|EHI_135110 294381.C4M0Z7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]