SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M194
Domain Number 1 Region: 1186-1410
Classification Level Classification E-value
Superfamily BEACH domain 3.66e-37
Family BEACH domain 0.0009
Further Details:      
 
Domain Number 2 Region: 154-290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000264
Family Laminin G-like module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M194
Sequence length 1687
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MEDVNEVLLEETIPILCGVPYDPSIPINSSVYQIVPDIEEKIRNYINPKSLYQTLQLLIT
ENPLNISKLSKSFSSELVKKIKTSNGNELSVILGLLEQLLKIRLTTKDFTDLFHLYITSN
NCNVEILSLLNSLARFGGPERYYAFPGFLTCLYKTITIGTTDNWGISLTFRSRGNGVILS
IQSPSIGITITIKEGFLYIECGINTPSLITTPNKNDLQLNNRRVVNGKWYNLIITHSKRE
QRLVVEIEKENFTFSLNYPKNEEAIISIGGISSNSKSYFTGDITDVIILPEETIIRYDQK
ELTKDMLLFECYKISNFTPIVTIIRETPGAIINRIGGISKLFILLNQKYNTRALEDCEKI
LDLYFRLLSTFKLLRQESIENNEISTIFQTLINLAEITKEQTFNETKKLQTPIVKEFISF
ALRLINSHSFLSIRNIILRHIFDIRWWPNDSLRVEYIKELQESMSHTVLGTLPFKLFEKL
SYRSLMLWILYDDIPEFEKETIPRAHLQWRCGYIQYITSIIIKDVYVVQYFMTDSLHLLD
TAIQTNDFNTEALLIYMYVCMVLTSQGELKSFISTMLKKNKTALLYLYIQQNPSFLKGNI
ERLLALINIEVKYNVIVDAMNSTRLTPLLYQIAIECSFNNIRNTYIDTTTTGYLSSKGFL
LNMNQMKLKQDFLTPFLKSISIAISNNLSNNMVVLDIILNDLVQCLENHIIWKYLLKSKY
WITIFIDIAVSLVSSKEYNILQRLQNIFARIIGIAFQQQNVSLENIICYLLSKLQNKEKF
YIIFRSLLKCLVKNVLCQLNNDSRDKMVIQMILLFSDFFCRTCSYGCDTALPHFEEDYEL
ITKCLEYHYPQPKLCNSKVASMQHVFIVHLILCQLHSIALKNNNIPLLRKTLQLIPPYLV
QRPQIEGYDSWVIFHLYDIVKQCDDPSVRRDISNMMYLLNFKQQPHMELDFKGIQLFGKE
LVSFYKTHENGLKVQADVLKVEENKLRNNPSFVFKEVQYPNLDVAPMDYNRLVMSDTDIR
LRLFTSSRRNWSNAFKSNILIDTVNSNTFKFEEIGFSEVRPIIVLKPVSIDENKISIITP
SSLEKEYREVLEKNKGLIHFKSLTSDDGIDGVLIYLSKKEIARIYINADNLQLIIKTPSK
IDEFGLNIITMVILRREEYIELYIKYHRPLLIHMKDSLKFLNNLSHITLNHQIQTVIYID
PVKAFNQSTIIKDWINGRMSNYMFINQLNFFAGYSYNDINNHPFFPWIDTSMSWETLICH
IIDNSKQHLLRNEFTLIPSPNPEVRTSIRLEPVDVCCLLYSIVPFTLLLPFYQAETLHGK
AIRSIDQLANSALVPQIYSYPLLMSLERLYILRMTLEMAVLSKELHKWLLKAFSILNGLP
KKKYEYDFSGIFLNQEGIKINVLPTNNGTVLTVGEEGFSVKSNNSGFNEISVFMRSCKMK
KVEGLNNIDVIYDGNEMIIIEALNGKTLIKQKGSVVDVNGKIISIIDSKKGTIEYVLKNS
IGVEWKYYNNNHQNTILKIEEIQPIQNAFISSKKCIVLFTENSFYCKSICGTIIYTKLFI
PHLFSLSANGFSYYVYQNTLHVETLNGIHKEIQLNLDYISMTTLTCLFLDFIILAQPNQI
TTYVFLGDRFVLLGSISFVDGWNITSVHSNCLINDDPTNWTFVVNCEKDNANSFVVYSLN
YITLKSN
Download sequence
Identical sequences A0A175JMK8 C4M194 M2QIN7 M3UHB6 N9TPV5
294381.C4M194 gi|56470663|gb|EAL48300.1| gi|67476170|ref|XP_653688.1| jCVI|EHI_188200 XP_653688.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]