SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M1Y5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M1Y5
Domain Number 1 Region: 4-238
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-47
Family Calponin-homology domain, CH-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M1Y5
Sequence length 457
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MKKNDGQWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEKII
ENPKFRIQNISNCTVALRFIEKVYKIKPLCSAENIVNGNSDFKYLLGLLFQIYMNHHKSN
LLSPQLSQQQQYEIILKWLQDILNLYEIDLSTTNKMMENFFNGKILIALLDLFFDQHHYF
YDWMLKRGEGERIGLSMRMAHDLLGVSELLTTEDVLAHTVDFRVFCFYFEFLMNAFKNKS
SVIQIDLVQLVQQAFEQLSKQTNQEKKQSKEEEVLTNQINLPPKQPKKKCASVSSQKVVP
ISSPSIQTKSEVNQHPQEQNSFKPIVLKDVMQHGRVKECIDEPISKTFNKKNEENSLKIT
SEKTIHKTKPLPPPKKSTEITLTTFDVGKSGLRHRKHLHTNERSHRYSRTEDPYSITQIY
SSTSYSTNGRITTTSEITETTEIQQNETIVFNGFWLI
Download sequence
Identical sequences A0A175JNN1 C4M1Y5 M2Q5H7 M3UJ35 M7WDX3 N9TIP6
gi|56472327|gb|EAL49820.1| gi|67479649|ref|XP_655206.1| XP_655206.1.49425 jCVI|EHI_164920 294381.C4M1Y5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]