SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M261 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M261
Domain Number 1 Region: 83-156
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.71e-22
Family Skp1 dimerisation domain-like 0.0007
Further Details:      
 
Domain Number 2 Region: 4-66
Classification Level Classification E-value
Superfamily POZ domain 1.73e-16
Family BTB/POZ domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M261
Sequence length 158
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MAQNVILRSSDGKDFTISEEAAKQSGLVESLMKDRENADEPVPILKVEGAVLEKVIQWLL
FHNEHPLMYPDFVIGDRDKNADLHPWDVKFCDDLEKDMLFEMLKAATFMNIDMLVEATAK
TIAKNLIGKTVEQMREYLNEENDYTPEEIEELKKKYAD
Download sequence
Identical sequences A0A175JPG3 C4M261
gi|56467834|gb|EAL45753.1| gi|56469352|gb|EAL47109.1| gi|56469355|gb|EAL47112.1| gi|67470342|ref|XP_651139.1| gi|67473457|ref|XP_652495.1| gi|67473465|ref|XP_652499.1| XP_651139.1.49425 XP_652495.1.49425 XP_652499.1.49425 294381.C4M261 jCVI|EHI_066770 jCVI|EHI_174130 jCVI|EHI_174180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]