SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M4C9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M4C9
Domain Number 1 Region: 11-99
Classification Level Classification E-value
Superfamily BRCT domain 2.36e-23
Family DNA ligase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M4C9
Sequence length 102
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MTTQPIQEISNQFLSGYVICVSGYSTDERVLLGGMIEQFGGIYMEDMESRSVSFLLSKGL
TSDKARHAKRWGVPVLNHQWLFDCIVERRFVSINNYILSLSM
Download sequence
Identical sequences A0A175JR37 C4M4C9 K2GUF9 M2Q675 M3TXH6 M7VXI4 N9VAI1
jCVI|EHI_156290 294381.C4M4C9 gi|56469821|gb|EAL47530.1| gi|67474336|ref|XP_652917.1| XP_008860160.1.50645 XP_652917.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]