SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M6L1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  294381.C4M6L1
Domain Number - Region: 104-143
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0262
Family Calcium ATPase, transmembrane domain M 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M6L1
Sequence length 150
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MMNNQYTPNSNINGNFPNQQPFNQYYCQPNQMTQPYNPVTNQNEIKTPPTMLYANQPIGY
STYPFYNQQPTPSLPQQPLTPSNDTLLAPPYDNNSTVIPMTQEEAQTPKKTCQQKLITAF
IISLFLFFFLIFFITFISVMGNMFFLMLSN
Download sequence
Identical sequences A0A175JTN4 C4M6L1 M3UST8 M7WCC9 N9UV42
XP_652393.1.49425 gi|56469244|gb|EAL47007.1| gi|67473253|ref|XP_652393.1| 294381.C4M6L1 jCVI|EHI_065340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]