SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M7V2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M7V2
Domain Number 1 Region: 188-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 
Weak hits

Sequence:  294381.C4M7V2
Domain Number - Region: 98-169
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00611
Family Eukaryotic type KH-domain (KH-domain type I) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M7V2
Sequence length 264
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MSVTDKIHEEKKPKKKWDVVNEDFLKLLKEKGQNISIAISDPTQALIVVPQKVAIATIGS
NDLEDLLAQQKKGTFEYSKNICINHLDQTLRTCLLKTSTHKHLQKEYNILVCVKGNYQPQ
FEEKEFDPDDSSTYINKCGQIPLYLLVRGDTEKELNRGVNAINEILNGTLTIEIYPPPFK
NEEDKILFYKKIIGKDHQNIQYIEKKTGVQLLVKGSGSEEVYNDSIKPLHFVIVSKVPIA
LLKAKSLCDNLISHIKDKWYEGKR
Download sequence
Identical sequences A0A175JWA3 C4M7V2 M2S7L3 M7W7V8 N9TJD9
294381.C4M7V2 jCVI|EHI_020360 gi|56471648|gb|EAL49201.1| gi|67478371|ref|XP_654587.1| XP_654587.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]