SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4MB06 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4MB06
Domain Number 1 Region: 539-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000142
Family SPRY domain 0.045
Further Details:      
 
Weak hits

Sequence:  294381.C4MB06
Domain Number - Region: 301-443
Classification Level Classification E-value
Superfamily L domain-like 0.00612
Family Leucine rich effector protein YopM 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4MB06
Sequence length 678
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MNVVLFFPTYRDIYRFIKVNHKCLDTIKGLKTNPMFYSSESFVSFFKRFQTDTFEVCGIY
FCYNEWFERARCIKSPYFHPLIGYQEKILNVLPKIVSLDLCSDDTISDTINFFIKYAHRF
TKLQSITGSIENLIKFFKQYTNNGENMFIQFPRLIFTSTSNNNFLQLNDQTIDLVNELTR
YIRQNGETRIIVLFNTHTSNADLIKRMKGIEYRHRGFINNPTPYCLENYCSFDGSFLIQN
TIEINQFNIIINKAYSNSEIISGIPGKSLLINPNQNIAPWSIPESVKKVSLQYISSEIEN
NMVSLSLISNNLKTLKITECKYLRFKTPFPSLEHLIIHICDYISFEMIDDMFLSLISITI
SSSYNISLSVSSPKLEEILLFFNEEINICGKVPSSFSKLFIRQSKNCKLPEISFKTLNLL
IEESPHLEFLNKSNQRISPMKYEGLSVEQSEQLCNLLLYLPSELSINEMLNPSNHFIFRR
FYSVSKSLKIVDNRVIKTEDFVDDNYQFYSQKFYVKNNKNLKMKVYDSKNELHEIPASIR
YFELTVSGYNVISIGIMGVGIYPFEGSRHLGWDQGSIGFHSDCGDLFNEGKASEYGIPFG
LNEDEVHIVGCGFDTINSQVFFTLDGKKYPSINVRWTDITAGFTVTDMDWIEINYGQNPF
SFDLYQYYVQNQRFCIIV
Download sequence
Identical sequences C4MB06 N9V9G5
XP_656083.2.49425 gi|169800462|gb|EAL50697.2| gi|183235602|ref|XP_656083.2| 294381.C4MB06 jCVI|EHI_016000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]