SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 295319.SPA3149 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295319.SPA3149
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-49
Family Ribonuclease PH domain 1-like 0.0000143
Further Details:      
 
Domain Number 2 Region: 301-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.14e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.4e-31
Family Ribonuclease PH domain 2-like 0.00079
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 226-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.11e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 608-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.94e-23
Family Cold shock DNA-binding domain-like 0.0000246
Further Details:      
 
Domain Number 7 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.86e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 295319.SPA3149
Sequence length 711
Comment (Salmonella enterica Paratypi ATCC 9150)
Sequence
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQDFFPLT
VNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPVRPLFPEGFVNEVQVIATVVSV
NPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKLDLVVA
GTEAAVLMVESEAELLSEDTMLGAVVFGHEQQQVVIQAINDLVKEAGKPRWDWQPEAVND
ALNARVAALAESRLSDAYRITDKQERYAQVDVIKSETIEQLIAEDETLDANELGEILHAI
EKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTAR
DAQVLDELMGERTDSFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPDMDK
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGDNYVVLSD
ILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQAKGARLHILGVMEQA
INAPRGDISEFAPRIHTIKISTDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGEKAKYAIRRIEEITAEIEVGRIYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVPVKVLEVDRQGRVRLSIKEATEQSQPAAAPEAPASEQAE
Download sequence
Identical sequences A0A0F6B766 A0A0H3NM73 A0A0J0X007 A0A0L5XQP6 A0A0M0QL48 A0A0Q9Z5G9 A0A0R9NLW3 A0A1C2ZYX6 A0A1X2RN42 A0A1X2UM14 A0A1X2Y0Z9 A0A1Z3QD86 A0A221YWU3 A0A221ZAF8 A0A249V536 A0A265B471 A0A267SE28 A0A271CEH8 A0A271CYK7 A0A2C6G2J6 A0A2C9P6F1 A0A2D1XK56 A0A2D1XYD4 A0A2D3AQH1 A0A2D3U2L9 A0A2G1NHJ5 A0A2I6MEV7 A0A2I6MSC8 A0A2I6N6B1 A0A2I6NJM1 A0A2I6NXL6 A0A2K2ZIU0 A9N728 B5BGJ1 B5QZV4 B5REN2 C0PZ50 Q57JI3 Q5PL97 Q8ZLT3
gi|549725843|ref|YP_008646033.1| AE006468|CDS_3451382-3449247 AM933172|CDS_3333416-3331281 AM933173|CDS_3310652-3308517 CP000026|CDS_3260137-3258002 CP001363|CDS_3464566-3462431 FM200053|CDS_3255812-3253677 gi|378452099|ref|YP_005239459.1| gi|378701183|ref|YP_005183141.1| gi|207858532|ref|YP_002245183.1| 295319.SPA3149 550537.SEN3117 550538.SG3173 554290.SSPA2940 99287.STM3282 gi|205354186|ref|YP_002227987.1| NP_462195.1.58477 WP_001670767.1.100002 WP_001670767.1.100007 WP_001670767.1.100010 WP_001670767.1.100017 WP_001670767.1.100031 WP_001670767.1.100077 WP_001670767.1.100115 WP_001670767.1.100129 WP_001670767.1.10013 WP_001670767.1.100137 WP_001670767.1.100149 WP_001670767.1.100165 WP_001670767.1.100191 WP_001670767.1.1002 WP_001670767.1.100234 WP_001670767.1.100258 WP_001670767.1.100266 WP_001670767.1.100288 WP_001670767.1.100376 WP_001670767.1.100392 WP_001670767.1.100412 WP_001670767.1.100413 WP_001670767.1.100424 WP_001670767.1.100432 WP_001670767.1.100436 WP_001670767.1.100438 WP_001670767.1.100457 WP_001670767.1.100472 WP_001670767.1.100484 WP_001670767.1.100488 WP_001670767.1.100502 WP_001670767.1.100519 WP_001670767.1.100521 WP_001670767.1.100541 WP_001670767.1.100557 WP_001670767.1.100584 WP_001670767.1.100597 WP_001670767.1.100605 WP_001670767.1.100642 WP_001670767.1.10065 WP_001670767.1.100650 WP_001670767.1.100707 WP_001670767.1.100711 WP_001670767.1.100714 WP_001670767.1.100721 WP_001670767.1.100730 WP_001670767.1.10074 WP_001670767.1.100750 WP_001670767.1.10076 WP_001670767.1.100773 WP_001670767.1.100776 WP_001670767.1.100781 WP_001670767.1.100790 WP_001670767.1.100793 WP_001670767.1.10081 WP_001670767.1.100814 WP_001670767.1.100857 WP_001670767.1.100865 WP_001670767.1.100869 WP_001670767.1.100870 WP_001670767.1.100882 WP_001670767.1.100886 WP_001670767.1.100895 WP_001670767.1.100932 WP_001670767.1.100944 WP_001670767.1.100948 WP_001670767.1.101007 WP_001670767.1.101020 WP_001670767.1.101042 WP_001670767.1.101074 WP_001670767.1.101078 WP_001670767.1.101091 WP_001670767.1.101094 WP_001670767.1.101111 WP_001670767.1.101112 WP_001670767.1.101123 WP_001670767.1.101126 WP_001670767.1.101147 WP_001670767.1.101180 WP_001670767.1.101185 WP_001670767.1.101223 WP_001670767.1.101239 WP_001670767.1.101259 WP_001670767.1.101284 WP_001670767.1.101291 WP_001670767.1.1013 WP_001670767.1.101320 WP_001670767.1.101353 WP_001670767.1.101386 WP_001670767.1.101404 WP_001670767.1.101420 WP_001670767.1.101425 WP_001670767.1.101454 WP_001670767.1.101473 WP_001670767.1.101519 WP_001670767.1.101520 WP_001670767.1.101541 WP_001670767.1.101589 WP_001670767.1.101609 WP_001670767.1.101612 WP_001670767.1.101634 WP_001670767.1.101636 WP_001670767.1.101639 WP_001670767.1.10164 WP_001670767.1.101674 WP_001670767.1.101707 WP_001670767.1.101724 WP_001670767.1.101734 WP_001670767.1.101740 WP_001670767.1.101741 WP_001670767.1.101744 WP_001670767.1.101759 WP_001670767.1.10177 WP_001670767.1.101776 WP_001670767.1.101815 WP_001670767.1.101832 WP_001670767.1.101839 WP_001670767.1.101841 WP_001670767.1.101868 WP_001670767.1.101878 WP_001670767.1.101904 WP_001670767.1.10191 WP_001670767.1.101927 WP_001670767.1.101949 WP_001670767.1.101953 WP_001670767.1.101975 WP_001670767.1.102009 WP_001670767.1.102111 WP_001670767.1.10220 WP_001670767.1.10231 WP_001670767.1.10237 WP_001670767.1.10266 WP_001670767.1.10276 WP_001670767.1.10293 WP_001670767.1.10300 WP_001670767.1.10310 WP_001670767.1.10394 WP_001670767.1.10429 WP_001670767.1.10439 WP_001670767.1.10463 WP_001670767.1.10465 WP_001670767.1.10498 WP_001670767.1.10507 WP_001670767.1.10521 WP_001670767.1.10562 WP_001670767.1.10566 WP_001670767.1.10568 WP_001670767.1.106 WP_001670767.1.10631 WP_001670767.1.10675 WP_001670767.1.10678 WP_001670767.1.10711 WP_001670767.1.10720 WP_001670767.1.10753 WP_001670767.1.10755 WP_001670767.1.10797 WP_001670767.1.10868 WP_001670767.1.10898 WP_001670767.1.10992 WP_001670767.1.11000 WP_001670767.1.11024 WP_001670767.1.11031 WP_001670767.1.11098 WP_001670767.1.1110 WP_001670767.1.11119 WP_001670767.1.11156 WP_001670767.1.11168 WP_001670767.1.11190 WP_001670767.1.11213 WP_001670767.1.11216 WP_001670767.1.11254 WP_001670767.1.11295 WP_001670767.1.11304 WP_001670767.1.1135 WP_001670767.1.11362 WP_001670767.1.11369 WP_001670767.1.1137 WP_001670767.1.11405 WP_001670767.1.11444 WP_001670767.1.11455 WP_001670767.1.11458 WP_001670767.1.11479 WP_001670767.1.1150 WP_001670767.1.11511 WP_001670767.1.11518 WP_001670767.1.11526 WP_001670767.1.11528 WP_001670767.1.11532 WP_001670767.1.11543 WP_001670767.1.11544 WP_001670767.1.11565 WP_001670767.1.11588 WP_001670767.1.11603 WP_001670767.1.11621 WP_001670767.1.11677 WP_001670767.1.11681 WP_001670767.1.11687 WP_001670767.1.1169 WP_001670767.1.11735 WP_001670767.1.1174 WP_001670767.1.11763 WP_001670767.1.11772 WP_001670767.1.11810 WP_001670767.1.11824 WP_001670767.1.11834 WP_001670767.1.11841 WP_001670767.1.11865 WP_001670767.1.11868 WP_001670767.1.11875 WP_001670767.1.11897 WP_001670767.1.11900 WP_001670767.1.11936 WP_001670767.1.11964 WP_001670767.1.11978 WP_001670767.1.12007 WP_001670767.1.12017 WP_001670767.1.12025 WP_001670767.1.12027 WP_001670767.1.12047 WP_001670767.1.12059 WP_001670767.1.12063 WP_001670767.1.12106 WP_001670767.1.12114 WP_001670767.1.12144 WP_001670767.1.1215 WP_001670767.1.12159 WP_001670767.1.12160 WP_001670767.1.12168 WP_001670767.1.12210 WP_001670767.1.12244 WP_001670767.1.12280 WP_001670767.1.12282 WP_001670767.1.12308 WP_001670767.1.12340 WP_001670767.1.12351 WP_001670767.1.12374 WP_001670767.1.1239 WP_001670767.1.12396 WP_001670767.1.12397 WP_001670767.1.1246 WP_001670767.1.12472 WP_001670767.1.12484 WP_001670767.1.12485 WP_001670767.1.1250 WP_001670767.1.12546 WP_001670767.1.12568 WP_001670767.1.12569 WP_001670767.1.12584 WP_001670767.1.12585 WP_001670767.1.1264 WP_001670767.1.12650 WP_001670767.1.12696 WP_001670767.1.12701 WP_001670767.1.12718 WP_001670767.1.12728 WP_001670767.1.12864 WP_001670767.1.12865 WP_001670767.1.12877 WP_001670767.1.12879 WP_001670767.1.12936 WP_001670767.1.1299 WP_001670767.1.12995 WP_001670767.1.1300 WP_001670767.1.13027 WP_001670767.1.13076 WP_001670767.1.13101 WP_001670767.1.13102 WP_001670767.1.13207 WP_001670767.1.13247 WP_001670767.1.1326 WP_001670767.1.13262 WP_001670767.1.13274 WP_001670767.1.13311 WP_001670767.1.13334 WP_001670767.1.13367 WP_001670767.1.13391 WP_001670767.1.13414 WP_001670767.1.13429 WP_001670767.1.13446 WP_001670767.1.1346 WP_001670767.1.13488 WP_001670767.1.13509 WP_001670767.1.13543 WP_001670767.1.13573 WP_001670767.1.13602 WP_001670767.1.13625 WP_001670767.1.13661 WP_001670767.1.13669 WP_001670767.1.13677 WP_001670767.1.13691 WP_001670767.1.13741 WP_001670767.1.13750 WP_001670767.1.13764 WP_001670767.1.13799 WP_001670767.1.13819 WP_001670767.1.13827 WP_001670767.1.13829 WP_001670767.1.13848 WP_001670767.1.13857 WP_001670767.1.1387 WP_001670767.1.13908 WP_001670767.1.13932 WP_001670767.1.13967 WP_001670767.1.13968 WP_001670767.1.14001 WP_001670767.1.14041 WP_001670767.1.14056 WP_001670767.1.14111 WP_001670767.1.1412 WP_001670767.1.14151 WP_001670767.1.14212 WP_001670767.1.14286 WP_001670767.1.14296 WP_001670767.1.14320 WP_001670767.1.14369 WP_001670767.1.1440 WP_001670767.1.14406 WP_001670767.1.14410 WP_001670767.1.14436 WP_001670767.1.14446 WP_001670767.1.14458 WP_001670767.1.14466 WP_001670767.1.14495 WP_001670767.1.14505 WP_001670767.1.14516 WP_001670767.1.14524 WP_001670767.1.14528 WP_001670767.1.14554 WP_001670767.1.146 WP_001670767.1.14618 WP_001670767.1.14688 WP_001670767.1.14706 WP_001670767.1.14708 WP_001670767.1.14725 WP_001670767.1.14737 WP_001670767.1.14789 WP_001670767.1.14793 WP_001670767.1.14819 WP_001670767.1.14852 WP_001670767.1.14876 WP_001670767.1.14884 WP_001670767.1.1489 WP_001670767.1.14913 WP_001670767.1.14917 WP_001670767.1.14927 WP_001670767.1.14932 WP_001670767.1.14936 WP_001670767.1.14964 WP_001670767.1.15011 WP_001670767.1.15046 WP_001670767.1.15054 WP_001670767.1.15055 WP_001670767.1.15059 WP_001670767.1.15067 WP_001670767.1.15079 WP_001670767.1.15100 WP_001670767.1.15102 WP_001670767.1.15124 WP_001670767.1.15214 WP_001670767.1.15223 WP_001670767.1.15226 WP_001670767.1.15276 WP_001670767.1.15316 WP_001670767.1.15318 WP_001670767.1.15353 WP_001670767.1.15369 WP_001670767.1.1540 WP_001670767.1.15468 WP_001670767.1.15479 WP_001670767.1.15483 WP_001670767.1.15508 WP_001670767.1.1551 WP_001670767.1.15585 WP_001670767.1.15586 WP_001670767.1.15612 WP_001670767.1.15616 WP_001670767.1.15625 WP_001670767.1.15627 WP_001670767.1.15637 WP_001670767.1.1568 WP_001670767.1.15708 WP_001670767.1.15775 WP_001670767.1.15777 WP_001670767.1.15784 WP_001670767.1.15795 WP_001670767.1.158 WP_001670767.1.15830 WP_001670767.1.15835 WP_001670767.1.15862 WP_001670767.1.15881 WP_001670767.1.15909 WP_001670767.1.15910 WP_001670767.1.1592 WP_001670767.1.15938 WP_001670767.1.15978 WP_001670767.1.15986 WP_001670767.1.15995 WP_001670767.1.16000 WP_001670767.1.16004 WP_001670767.1.16006 WP_001670767.1.1601 WP_001670767.1.16028 WP_001670767.1.16032 WP_001670767.1.16047 WP_001670767.1.16052 WP_001670767.1.16062 WP_001670767.1.16063 WP_001670767.1.16103 WP_001670767.1.16125 WP_001670767.1.16158 WP_001670767.1.16166 WP_001670767.1.16172 WP_001670767.1.16226 WP_001670767.1.16233 WP_001670767.1.16273 WP_001670767.1.16284 WP_001670767.1.16328 WP_001670767.1.16331 WP_001670767.1.1635 WP_001670767.1.16361 WP_001670767.1.16363 WP_001670767.1.16365 WP_001670767.1.16366 WP_001670767.1.16394 WP_001670767.1.16453 WP_001670767.1.16468 WP_001670767.1.16474 WP_001670767.1.16508 WP_001670767.1.16525 WP_001670767.1.16551 WP_001670767.1.16565 WP_001670767.1.16581 WP_001670767.1.16614 WP_001670767.1.16650 WP_001670767.1.16656 WP_001670767.1.1668 WP_001670767.1.16686 WP_001670767.1.16691 WP_001670767.1.167 WP_001670767.1.16710 WP_001670767.1.16729 WP_001670767.1.16732 WP_001670767.1.16735 WP_001670767.1.16786 WP_001670767.1.16804 WP_001670767.1.16817 WP_001670767.1.16819 WP_001670767.1.16826 WP_001670767.1.16846 WP_001670767.1.16855 WP_001670767.1.16858 WP_001670767.1.16873 WP_001670767.1.1689 WP_001670767.1.16896 WP_001670767.1.16903 WP_001670767.1.16910 WP_001670767.1.16941 WP_001670767.1.16942 WP_001670767.1.16944 WP_001670767.1.16972 WP_001670767.1.16998 WP_001670767.1.1700 WP_001670767.1.17031 WP_001670767.1.17060 WP_001670767.1.17093 WP_001670767.1.17096 WP_001670767.1.17098 WP_001670767.1.17105 WP_001670767.1.17188 WP_001670767.1.17270 WP_001670767.1.17285 WP_001670767.1.17307 WP_001670767.1.1733 WP_001670767.1.17390 WP_001670767.1.174 WP_001670767.1.17439 WP_001670767.1.17447 WP_001670767.1.17480 WP_001670767.1.17482 WP_001670767.1.1749 WP_001670767.1.17504 WP_001670767.1.17525 WP_001670767.1.17546 WP_001670767.1.17560 WP_001670767.1.1757 WP_001670767.1.17583 WP_001670767.1.17629 WP_001670767.1.17693 WP_001670767.1.17702 WP_001670767.1.17703 WP_001670767.1.17705 WP_001670767.1.17732 WP_001670767.1.17743 WP_001670767.1.17747 WP_001670767.1.17755 WP_001670767.1.17758 WP_001670767.1.17865 WP_001670767.1.17886 WP_001670767.1.17891 WP_001670767.1.17901 WP_001670767.1.17914 WP_001670767.1.17919 WP_001670767.1.17936 WP_001670767.1.17949 WP_001670767.1.1798 WP_001670767.1.17991 WP_001670767.1.18019 WP_001670767.1.18022 WP_001670767.1.18056 WP_001670767.1.18061 WP_001670767.1.1807 WP_001670767.1.18089 WP_001670767.1.18092 WP_001670767.1.18109 WP_001670767.1.18111 WP_001670767.1.18122 WP_001670767.1.1814 WP_001670767.1.18149 WP_001670767.1.18163 WP_001670767.1.18178 WP_001670767.1.1818 WP_001670767.1.18192 WP_001670767.1.1825 WP_001670767.1.18254 WP_001670767.1.18265 WP_001670767.1.18267 WP_001670767.1.18277 WP_001670767.1.18281 WP_001670767.1.18282 WP_001670767.1.18355 WP_001670767.1.18365 WP_001670767.1.18384 WP_001670767.1.18445 WP_001670767.1.18468 WP_001670767.1.18485 WP_001670767.1.18489 WP_001670767.1.18607 WP_001670767.1.18641 WP_001670767.1.18686 WP_001670767.1.18692 WP_001670767.1.18705 WP_001670767.1.18715 WP_001670767.1.18737 WP_001670767.1.18776 WP_001670767.1.18822 WP_001670767.1.18847 WP_001670767.1.18881 WP_001670767.1.18886 WP_001670767.1.18895 WP_001670767.1.18919 WP_001670767.1.18940 WP_001670767.1.18949 WP_001670767.1.1895 WP_001670767.1.1897 WP_001670767.1.18972 WP_001670767.1.19030 WP_001670767.1.19038 WP_001670767.1.19053 WP_001670767.1.19055 WP_001670767.1.19093 WP_001670767.1.19163 WP_001670767.1.19174 WP_001670767.1.19240 WP_001670767.1.19273 WP_001670767.1.19291 WP_001670767.1.19340 WP_001670767.1.19357 WP_001670767.1.19373 WP_001670767.1.1939 WP_001670767.1.19405 WP_001670767.1.19433 WP_001670767.1.19458 WP_001670767.1.19460 WP_001670767.1.19461 WP_001670767.1.19469 WP_001670767.1.1954 WP_001670767.1.1955 WP_001670767.1.19588 WP_001670767.1.19614 WP_001670767.1.19616 WP_001670767.1.19642 WP_001670767.1.19656 WP_001670767.1.19660 WP_001670767.1.1968 WP_001670767.1.19683 WP_001670767.1.19702 WP_001670767.1.19706 WP_001670767.1.19723 WP_001670767.1.19724 WP_001670767.1.19740 WP_001670767.1.19784 WP_001670767.1.19793 WP_001670767.1.19802 WP_001670767.1.19809 WP_001670767.1.19823 WP_001670767.1.19834 WP_001670767.1.19851 WP_001670767.1.19863 WP_001670767.1.19867 WP_001670767.1.19882 WP_001670767.1.19884 WP_001670767.1.1990 WP_001670767.1.19938 WP_001670767.1.19967 WP_001670767.1.19975 WP_001670767.1.1998 WP_001670767.1.19987 WP_001670767.1.20 WP_001670767.1.20023 WP_001670767.1.20034 WP_001670767.1.20081 WP_001670767.1.20086 WP_001670767.1.20089 WP_001670767.1.20091 WP_001670767.1.2010 WP_001670767.1.20119 WP_001670767.1.20212 WP_001670767.1.20218 WP_001670767.1.2026 WP_001670767.1.20261 WP_001670767.1.20266 WP_001670767.1.20271 WP_001670767.1.20330 WP_001670767.1.20349 WP_001670767.1.2036 WP_001670767.1.20362 WP_001670767.1.20364 WP_001670767.1.20376 WP_001670767.1.20391 WP_001670767.1.2041 WP_001670767.1.20415 WP_001670767.1.20418 WP_001670767.1.20425 WP_001670767.1.20437 WP_001670767.1.20443 WP_001670767.1.20446 WP_001670767.1.2047 WP_001670767.1.20488 WP_001670767.1.20503 WP_001670767.1.2054 WP_001670767.1.20553 WP_001670767.1.20564 WP_001670767.1.20573 WP_001670767.1.20614 WP_001670767.1.20626 WP_001670767.1.20631 WP_001670767.1.20646 WP_001670767.1.20695 WP_001670767.1.20700 WP_001670767.1.20721 WP_001670767.1.20760 WP_001670767.1.20767 WP_001670767.1.20787 WP_001670767.1.20789 WP_001670767.1.20795 WP_001670767.1.20810 WP_001670767.1.20839 WP_001670767.1.20862 WP_001670767.1.20886 WP_001670767.1.20900 WP_001670767.1.20908 WP_001670767.1.2091 WP_001670767.1.2101 WP_001670767.1.21049 WP_001670767.1.2107 WP_001670767.1.21075 WP_001670767.1.21079 WP_001670767.1.21086 WP_001670767.1.21089 WP_001670767.1.21103 WP_001670767.1.21136 WP_001670767.1.2116 WP_001670767.1.21165 WP_001670767.1.21194 WP_001670767.1.21202 WP_001670767.1.21241 WP_001670767.1.21245 WP_001670767.1.21246 WP_001670767.1.21260 WP_001670767.1.21269 WP_001670767.1.21286 WP_001670767.1.2130 WP_001670767.1.21309 WP_001670767.1.21326 WP_001670767.1.21332 WP_001670767.1.21351 WP_001670767.1.21362 WP_001670767.1.2139 WP_001670767.1.21399 WP_001670767.1.21400 WP_001670767.1.21404 WP_001670767.1.21423 WP_001670767.1.21443 WP_001670767.1.2146 WP_001670767.1.21473 WP_001670767.1.21497 WP_001670767.1.21499 WP_001670767.1.21534 WP_001670767.1.21548 WP_001670767.1.21603 WP_001670767.1.21616 WP_001670767.1.21681 WP_001670767.1.21692 WP_001670767.1.21715 WP_001670767.1.21728 WP_001670767.1.21730 WP_001670767.1.21750 WP_001670767.1.21751 WP_001670767.1.21757 WP_001670767.1.21792 WP_001670767.1.21825 WP_001670767.1.21845 WP_001670767.1.21877 WP_001670767.1.21886 WP_001670767.1.21909 WP_001670767.1.21910 WP_001670767.1.21940 WP_001670767.1.21950 WP_001670767.1.21981 WP_001670767.1.21991 WP_001670767.1.22019 WP_001670767.1.22024 WP_001670767.1.22030 WP_001670767.1.2205 WP_001670767.1.22051 WP_001670767.1.22062 WP_001670767.1.22067 WP_001670767.1.22069 WP_001670767.1.22096 WP_001670767.1.22117 WP_001670767.1.22136 WP_001670767.1.22158 WP_001670767.1.22162 WP_001670767.1.22169 WP_001670767.1.22205 WP_001670767.1.2221 WP_001670767.1.22235 WP_001670767.1.2224 WP_001670767.1.22240 WP_001670767.1.22270 WP_001670767.1.22296 WP_001670767.1.22315 WP_001670767.1.22323 WP_001670767.1.22337 WP_001670767.1.22346 WP_001670767.1.2235 WP_001670767.1.22379 WP_001670767.1.22427 WP_001670767.1.22449 WP_001670767.1.22451 WP_001670767.1.22453 WP_001670767.1.22454 WP_001670767.1.2246 WP_001670767.1.22460 WP_001670767.1.22485 WP_001670767.1.22514 WP_001670767.1.22537 WP_001670767.1.22565 WP_001670767.1.22566 WP_001670767.1.22575 WP_001670767.1.22582 WP_001670767.1.22590 WP_001670767.1.22595 WP_001670767.1.22604 WP_001670767.1.22605 WP_001670767.1.22620 WP_001670767.1.22623 WP_001670767.1.22676 WP_001670767.1.22692 WP_001670767.1.22758 WP_001670767.1.2283 WP_001670767.1.22845 WP_001670767.1.22857 WP_001670767.1.22864 WP_001670767.1.22870 WP_001670767.1.22880 WP_001670767.1.22902 WP_001670767.1.22947 WP_001670767.1.22966 WP_001670767.1.22979 WP_001670767.1.23010 WP_001670767.1.23053 WP_001670767.1.23080 WP_001670767.1.23102 WP_001670767.1.23114 WP_001670767.1.2314 WP_001670767.1.23148 WP_001670767.1.23155 WP_001670767.1.23169 WP_001670767.1.23172 WP_001670767.1.23175 WP_001670767.1.23192 WP_001670767.1.23201 WP_001670767.1.2324 WP_001670767.1.23246 WP_001670767.1.23258 WP_001670767.1.23259 WP_001670767.1.23274 WP_001670767.1.23279 WP_001670767.1.23309 WP_001670767.1.23311 WP_001670767.1.23329 WP_001670767.1.23343 WP_001670767.1.23379 WP_001670767.1.23409 WP_001670767.1.2342 WP_001670767.1.23442 WP_001670767.1.23444 WP_001670767.1.23460 WP_001670767.1.23466 WP_001670767.1.23472 WP_001670767.1.23482 WP_001670767.1.23485 WP_001670767.1.235 WP_001670767.1.23500 WP_001670767.1.23503 WP_001670767.1.23509 WP_001670767.1.23513 WP_001670767.1.23529 WP_001670767.1.2358 WP_001670767.1.23587 WP_001670767.1.23621 WP_001670767.1.23629 WP_001670767.1.23631 WP_001670767.1.23634 WP_001670767.1.23639 WP_001670767.1.2364 WP_001670767.1.23643 WP_001670767.1.23646 WP_001670767.1.23670 WP_001670767.1.23675 WP_001670767.1.23685 WP_001670767.1.237 WP_001670767.1.23720 WP_001670767.1.23736 WP_001670767.1.23755 WP_001670767.1.2376 WP_001670767.1.2380 WP_001670767.1.23819 WP_001670767.1.23932 WP_001670767.1.23959 WP_001670767.1.24017 WP_001670767.1.24082 WP_001670767.1.24145 WP_001670767.1.2415 WP_001670767.1.24158 WP_001670767.1.24163 WP_001670767.1.24206 WP_001670767.1.24214 WP_001670767.1.24250 WP_001670767.1.24259 WP_001670767.1.24297 WP_001670767.1.24303 WP_001670767.1.24308 WP_001670767.1.24325 WP_001670767.1.24361 WP_001670767.1.24376 WP_001670767.1.24392 WP_001670767.1.24394 WP_001670767.1.24408 WP_001670767.1.24409 WP_001670767.1.24412 WP_001670767.1.24419 WP_001670767.1.24433 WP_001670767.1.24444 WP_001670767.1.24450 WP_001670767.1.24476 WP_001670767.1.24494 WP_001670767.1.24521 WP_001670767.1.24555 WP_001670767.1.24578 WP_001670767.1.2467 WP_001670767.1.24673 WP_001670767.1.24686 WP_001670767.1.24689 WP_001670767.1.24723 WP_001670767.1.24737 WP_001670767.1.24779 WP_001670767.1.24803 WP_001670767.1.24839 WP_001670767.1.24873 WP_001670767.1.24901 WP_001670767.1.24944 WP_001670767.1.24995 WP_001670767.1.25008 WP_001670767.1.25015 WP_001670767.1.25036 WP_001670767.1.25064 WP_001670767.1.25072 WP_001670767.1.25119 WP_001670767.1.25130 WP_001670767.1.25159 WP_001670767.1.25175 WP_001670767.1.25205 WP_001670767.1.25206 WP_001670767.1.25229 WP_001670767.1.2525 WP_001670767.1.25297 WP_001670767.1.25354 WP_001670767.1.25397 WP_001670767.1.25405 WP_001670767.1.25421 WP_001670767.1.25426 WP_001670767.1.25454 WP_001670767.1.25493 WP_001670767.1.25498 WP_001670767.1.25514 WP_001670767.1.2554 WP_001670767.1.25546 WP_001670767.1.25564 WP_001670767.1.25618 WP_001670767.1.25668 WP_001670767.1.2568 WP_001670767.1.25690 WP_001670767.1.2570 WP_001670767.1.25700 WP_001670767.1.25703 WP_001670767.1.25708 WP_001670767.1.25709 WP_001670767.1.25722 WP_001670767.1.25740 WP_001670767.1.25780 WP_001670767.1.25793 WP_001670767.1.25809 WP_001670767.1.2581 WP_001670767.1.25814 WP_001670767.1.25846 WP_001670767.1.25928 WP_001670767.1.25932 WP_001670767.1.25951 WP_001670767.1.25988 WP_001670767.1.26030 WP_001670767.1.26075 WP_001670767.1.26083 WP_001670767.1.26093 WP_001670767.1.26122 WP_001670767.1.26123 WP_001670767.1.26129 WP_001670767.1.26194 WP_001670767.1.26199 WP_001670767.1.26213 WP_001670767.1.26224 WP_001670767.1.26269 WP_001670767.1.26311 WP_001670767.1.26319 WP_001670767.1.2634 WP_001670767.1.26363 WP_001670767.1.26426 WP_001670767.1.26429 WP_001670767.1.26440 WP_001670767.1.26441 WP_001670767.1.26493 WP_001670767.1.26512 WP_001670767.1.26532 WP_001670767.1.26551 WP_001670767.1.26567 WP_001670767.1.26576 WP_001670767.1.26582 WP_001670767.1.26587 WP_001670767.1.2660 WP_001670767.1.26646 WP_001670767.1.2667 WP_001670767.1.26687 WP_001670767.1.26709 WP_001670767.1.2672 WP_001670767.1.26741 WP_001670767.1.26750 WP_001670767.1.26758 WP_001670767.1.26833 WP_001670767.1.26856 WP_001670767.1.26882 WP_001670767.1.26883 WP_001670767.1.26892 WP_001670767.1.26919 WP_001670767.1.26924 WP_001670767.1.26936 WP_001670767.1.26980 WP_001670767.1.27010 WP_001670767.1.27051 WP_001670767.1.27055 WP_001670767.1.27072 WP_001670767.1.27084 WP_001670767.1.27122 WP_001670767.1.27169 WP_001670767.1.27173 WP_001670767.1.272 WP_001670767.1.27206 WP_001670767.1.27223 WP_001670767.1.2723 WP_001670767.1.27255 WP_001670767.1.27272 WP_001670767.1.27279 WP_001670767.1.27342 WP_001670767.1.27383 WP_001670767.1.27419 WP_001670767.1.27423 WP_001670767.1.27452 WP_001670767.1.27513 WP_001670767.1.27522 WP_001670767.1.27523 WP_001670767.1.27535 WP_001670767.1.27544 WP_001670767.1.27547 WP_001670767.1.27556 WP_001670767.1.27561 WP_001670767.1.27616 WP_001670767.1.2763 WP_001670767.1.27632 WP_001670767.1.27638 WP_001670767.1.27655 WP_001670767.1.27658 WP_001670767.1.27665 WP_001670767.1.27679 WP_001670767.1.27707 WP_001670767.1.27713 WP_001670767.1.27755 WP_001670767.1.27761 WP_001670767.1.2777 WP_001670767.1.27776 WP_001670767.1.27798 WP_001670767.1.27800 WP_001670767.1.27815 WP_001670767.1.27833 WP_001670767.1.27857 WP_001670767.1.27883 WP_001670767.1.27969 WP_001670767.1.27977 WP_001670767.1.27995 WP_001670767.1.27997 WP_001670767.1.28002 WP_001670767.1.28032 WP_001670767.1.28037 WP_001670767.1.28056 WP_001670767.1.2806 WP_001670767.1.28073 WP_001670767.1.28094 WP_001670767.1.28116 WP_001670767.1.28126 WP_001670767.1.28139 WP_001670767.1.28170 WP_001670767.1.28174 WP_001670767.1.28200 WP_001670767.1.28233 WP_001670767.1.28235 WP_001670767.1.2825 WP_001670767.1.28267 WP_001670767.1.2829 WP_001670767.1.28301 WP_001670767.1.28302 WP_001670767.1.28303 WP_001670767.1.2835 WP_001670767.1.28370 WP_001670767.1.28393 WP_001670767.1.28462 WP_001670767.1.28514 WP_001670767.1.2853 WP_001670767.1.28538 WP_001670767.1.28570 WP_001670767.1.28575 WP_001670767.1.28612 WP_001670767.1.28620 WP_001670767.1.28655 WP_001670767.1.28673 WP_001670767.1.28694 WP_001670767.1.287 WP_001670767.1.28733 WP_001670767.1.28773 WP_001670767.1.28775 WP_001670767.1.28776 WP_001670767.1.2879 WP_001670767.1.28811 WP_001670767.1.28830 WP_001670767.1.2890 WP_001670767.1.28921 WP_001670767.1.28938 WP_001670767.1.28946 WP_001670767.1.28948 WP_001670767.1.28963 WP_001670767.1.28977 WP_001670767.1.29006 WP_001670767.1.29010 WP_001670767.1.29099 WP_001670767.1.2910 WP_001670767.1.29113 WP_001670767.1.29130 WP_001670767.1.29168 WP_001670767.1.29174 WP_001670767.1.29190 WP_001670767.1.29218 WP_001670767.1.2924 WP_001670767.1.29255 WP_001670767.1.29265 WP_001670767.1.29274 WP_001670767.1.2932 WP_001670767.1.29349 WP_001670767.1.29379 WP_001670767.1.29422 WP_001670767.1.29436 WP_001670767.1.29454 WP_001670767.1.29509 WP_001670767.1.29530 WP_001670767.1.29588 WP_001670767.1.29593 WP_001670767.1.29601 WP_001670767.1.29606 WP_001670767.1.29615 WP_001670767.1.29619 WP_001670767.1.29682 WP_001670767.1.29704 WP_001670767.1.29711 WP_001670767.1.29732 WP_001670767.1.29768 WP_001670767.1.29774 WP_001670767.1.29827 WP_001670767.1.2984 WP_001670767.1.29845 WP_001670767.1.29923 WP_001670767.1.29924 WP_001670767.1.29969 WP_001670767.1.29990 WP_001670767.1.30006 WP_001670767.1.30018 WP_001670767.1.30022 WP_001670767.1.30027 WP_001670767.1.3005 WP_001670767.1.30059 WP_001670767.1.30086 WP_001670767.1.30165 WP_001670767.1.3017 WP_001670767.1.30170 WP_001670767.1.30179 WP_001670767.1.30180 WP_001670767.1.30195 WP_001670767.1.30202 WP_001670767.1.30210 WP_001670767.1.30213 WP_001670767.1.30225 WP_001670767.1.30238 WP_001670767.1.30246 WP_001670767.1.30278 WP_001670767.1.30331 WP_001670767.1.30356 WP_001670767.1.30386 WP_001670767.1.30389 WP_001670767.1.30425 WP_001670767.1.30437 WP_001670767.1.30469 WP_001670767.1.30492 WP_001670767.1.30505 WP_001670767.1.30507 WP_001670767.1.30535 WP_001670767.1.30547 WP_001670767.1.30548 WP_001670767.1.30555 WP_001670767.1.30573 WP_001670767.1.30589 WP_001670767.1.30602 WP_001670767.1.30619 WP_001670767.1.30627 WP_001670767.1.30635 WP_001670767.1.3066 WP_001670767.1.3067 WP_001670767.1.3068 WP_001670767.1.30696 WP_001670767.1.30752 WP_001670767.1.3076 WP_001670767.1.30794 WP_001670767.1.3080 WP_001670767.1.30802 WP_001670767.1.30819 WP_001670767.1.30823 WP_001670767.1.30833 WP_001670767.1.30835 WP_001670767.1.3089 WP_001670767.1.30909 WP_001670767.1.30934 WP_001670767.1.3095 WP_001670767.1.30968 WP_001670767.1.30972 WP_001670767.1.31 WP_001670767.1.31001 WP_001670767.1.31011 WP_001670767.1.31042 WP_001670767.1.31069 WP_001670767.1.31086 WP_001670767.1.31092 WP_001670767.1.31107 WP_001670767.1.31111 WP_001670767.1.31122 WP_001670767.1.3113 WP_001670767.1.3114 WP_001670767.1.31155 WP_001670767.1.31156 WP_001670767.1.31167 WP_001670767.1.31171 WP_001670767.1.31185 WP_001670767.1.3119 WP_001670767.1.31190 WP_001670767.1.31195 WP_001670767.1.31196 WP_001670767.1.31198 WP_001670767.1.31210 WP_001670767.1.31214 WP_001670767.1.31219 WP_001670767.1.31222 WP_001670767.1.3124 WP_001670767.1.31251 WP_001670767.1.31262 WP_001670767.1.3127 WP_001670767.1.31272 WP_001670767.1.31281 WP_001670767.1.31335 WP_001670767.1.31362 WP_001670767.1.31435 WP_001670767.1.31451 WP_001670767.1.31476 WP_001670767.1.31504 WP_001670767.1.31546 WP_001670767.1.31578 WP_001670767.1.31585 WP_001670767.1.31658 WP_001670767.1.31665 WP_001670767.1.3167 WP_001670767.1.31720 WP_001670767.1.31725 WP_001670767.1.31762 WP_001670767.1.31782 WP_001670767.1.31845 WP_001670767.1.3185 WP_001670767.1.31854 WP_001670767.1.31895 WP_001670767.1.31901 WP_001670767.1.31927 WP_001670767.1.31940 WP_001670767.1.31952 WP_001670767.1.31967 WP_001670767.1.31972 WP_001670767.1.31983 WP_001670767.1.32006 WP_001670767.1.32056 WP_001670767.1.32109 WP_001670767.1.32116 WP_001670767.1.32170 WP_001670767.1.32192 WP_001670767.1.32204 WP_001670767.1.32206 WP_001670767.1.32252 WP_001670767.1.32255 WP_001670767.1.32260 WP_001670767.1.32274 WP_001670767.1.32277 WP_001670767.1.32309 WP_001670767.1.32357 WP_001670767.1.32368 WP_001670767.1.32408 WP_001670767.1.32423 WP_001670767.1.32424 WP_001670767.1.32434 WP_001670767.1.32438 WP_001670767.1.32491 WP_001670767.1.32493 WP_001670767.1.32515 WP_001670767.1.32519 WP_001670767.1.32527 WP_001670767.1.32545 WP_001670767.1.32624 WP_001670767.1.32643 WP_001670767.1.32660 WP_001670767.1.32668 WP_001670767.1.32702 WP_001670767.1.32714 WP_001670767.1.32740 WP_001670767.1.32747 WP_001670767.1.32750 WP_001670767.1.3278 WP_001670767.1.32786 WP_001670767.1.32804 WP_001670767.1.32832 WP_001670767.1.32860 WP_001670767.1.32881 WP_001670767.1.32899 WP_001670767.1.329 WP_001670767.1.32900 WP_001670767.1.32902 WP_001670767.1.32907 WP_001670767.1.32930 WP_001670767.1.32961 WP_001670767.1.32977 WP_001670767.1.33010 WP_001670767.1.33030 WP_001670767.1.3304 WP_001670767.1.33078 WP_001670767.1.3310 WP_001670767.1.33106 WP_001670767.1.33114 WP_001670767.1.33127 WP_001670767.1.33143 WP_001670767.1.33144 WP_001670767.1.33160 WP_001670767.1.33248 WP_001670767.1.33253 WP_001670767.1.33261 WP_001670767.1.33270 WP_001670767.1.333 WP_001670767.1.33392 WP_001670767.1.33409 WP_001670767.1.33420 WP_001670767.1.33486 WP_001670767.1.33492 WP_001670767.1.33499 WP_001670767.1.335 WP_001670767.1.33504 WP_001670767.1.33553 WP_001670767.1.3356 WP_001670767.1.33580 WP_001670767.1.33586 WP_001670767.1.33592 WP_001670767.1.33609 WP_001670767.1.33629 WP_001670767.1.3364 WP_001670767.1.33659 WP_001670767.1.33693 WP_001670767.1.33817 WP_001670767.1.33825 WP_001670767.1.33865 WP_001670767.1.33894 WP_001670767.1.3394 WP_001670767.1.3396 WP_001670767.1.33986 WP_001670767.1.34 WP_001670767.1.34022 WP_001670767.1.34075 WP_001670767.1.34081 WP_001670767.1.34084 WP_001670767.1.34091 WP_001670767.1.34107 WP_001670767.1.34126 WP_001670767.1.34179 WP_001670767.1.34185 WP_001670767.1.34257 WP_001670767.1.34259 WP_001670767.1.34279 WP_001670767.1.34292 WP_001670767.1.34304 WP_001670767.1.34319 WP_001670767.1.34330 WP_001670767.1.3438 WP_001670767.1.34417 WP_001670767.1.34424 WP_001670767.1.34431 WP_001670767.1.3445 WP_001670767.1.34453 WP_001670767.1.34454 WP_001670767.1.34458 WP_001670767.1.34496 WP_001670767.1.34610 WP_001670767.1.34614 WP_001670767.1.34659 WP_001670767.1.34667 WP_001670767.1.34684 WP_001670767.1.34703 WP_001670767.1.34704 WP_001670767.1.34707 WP_001670767.1.34711 WP_001670767.1.34745 WP_001670767.1.3476 WP_001670767.1.34801 WP_001670767.1.34817 WP_001670767.1.34820 WP_001670767.1.34854 WP_001670767.1.34856 WP_001670767.1.34881 WP_001670767.1.3489 WP_001670767.1.34972 WP_001670767.1.34975 WP_001670767.1.34977 WP_001670767.1.35035 WP_001670767.1.35045 WP_001670767.1.35075 WP_001670767.1.35129 WP_001670767.1.35184 WP_001670767.1.35193 WP_001670767.1.35219 WP_001670767.1.35298 WP_001670767.1.35321 WP_001670767.1.35331 WP_001670767.1.35332 WP_001670767.1.35404 WP_001670767.1.35408 WP_001670767.1.3541 WP_001670767.1.35425 WP_001670767.1.35429 WP_001670767.1.35446 WP_001670767.1.35463 WP_001670767.1.35494 WP_001670767.1.35503 WP_001670767.1.35507 WP_001670767.1.35509 WP_001670767.1.3556 WP_001670767.1.35563 WP_001670767.1.35570 WP_001670767.1.35590 WP_001670767.1.35594 WP_001670767.1.35619 WP_001670767.1.35624 WP_001670767.1.35648 WP_001670767.1.3566 WP_001670767.1.3572 WP_001670767.1.35777 WP_001670767.1.35809 WP_001670767.1.35835 WP_001670767.1.35868 WP_001670767.1.35887 WP_001670767.1.35892 WP_001670767.1.35936 WP_001670767.1.35940 WP_001670767.1.35961 WP_001670767.1.35993 WP_001670767.1.36003 WP_001670767.1.3601 WP_001670767.1.36011 WP_001670767.1.36017 WP_001670767.1.36037 WP_001670767.1.36057 WP_001670767.1.36063 WP_001670767.1.3610 WP_001670767.1.36157 WP_001670767.1.36172 WP_001670767.1.36229 WP_001670767.1.36232 WP_001670767.1.36236 WP_001670767.1.36286 WP_001670767.1.36409 WP_001670767.1.36445 WP_001670767.1.36542 WP_001670767.1.36547 WP_001670767.1.36564 WP_001670767.1.36584 WP_001670767.1.36586 WP_001670767.1.36592 WP_001670767.1.36609 WP_001670767.1.36652 WP_001670767.1.36685 WP_001670767.1.36690 WP_001670767.1.3670 WP_001670767.1.36705 WP_001670767.1.36721 WP_001670767.1.36751 WP_001670767.1.36764 WP_001670767.1.36765 WP_001670767.1.36792 WP_001670767.1.36839 WP_001670767.1.36875 WP_001670767.1.3688 WP_001670767.1.36885 WP_001670767.1.36889 WP_001670767.1.36899 WP_001670767.1.36918 WP_001670767.1.36931 WP_001670767.1.36948 WP_001670767.1.36949 WP_001670767.1.36978 WP_001670767.1.37013 WP_001670767.1.37021 WP_001670767.1.37028 WP_001670767.1.37029 WP_001670767.1.37063 WP_001670767.1.37073 WP_001670767.1.37100 WP_001670767.1.37111 WP_001670767.1.37112 WP_001670767.1.37114 WP_001670767.1.37147 WP_001670767.1.37158 WP_001670767.1.37190 WP_001670767.1.37191 WP_001670767.1.37256 WP_001670767.1.3726 WP_001670767.1.37267 WP_001670767.1.3728 WP_001670767.1.37293 WP_001670767.1.37297 WP_001670767.1.37320 WP_001670767.1.37351 WP_001670767.1.37363 WP_001670767.1.37370 WP_001670767.1.37376 WP_001670767.1.37405 WP_001670767.1.3744 WP_001670767.1.37478 WP_001670767.1.3748 WP_001670767.1.37498 WP_001670767.1.37504 WP_001670767.1.3751 WP_001670767.1.37521 WP_001670767.1.37558 WP_001670767.1.3756 WP_001670767.1.37610 WP_001670767.1.37618 WP_001670767.1.37666 WP_001670767.1.37687 WP_001670767.1.3771 WP_001670767.1.37719 WP_001670767.1.3778 WP_001670767.1.37808 WP_001670767.1.37848 WP_001670767.1.37864 WP_001670767.1.3790 WP_001670767.1.37965 WP_001670767.1.37968 WP_001670767.1.37978 WP_001670767.1.38001 WP_001670767.1.38026 WP_001670767.1.38037 WP_001670767.1.38047 WP_001670767.1.38055 WP_001670767.1.38113 WP_001670767.1.38125 WP_001670767.1.38145 WP_001670767.1.38199 WP_001670767.1.38273 WP_001670767.1.3828 WP_001670767.1.383 WP_001670767.1.38322 WP_001670767.1.38341 WP_001670767.1.38344 WP_001670767.1.38349 WP_001670767.1.38393 WP_001670767.1.38408 WP_001670767.1.38452 WP_001670767.1.3848 WP_001670767.1.38512 WP_001670767.1.38569 WP_001670767.1.38613 WP_001670767.1.38620 WP_001670767.1.38622 WP_001670767.1.38673 WP_001670767.1.3869 WP_001670767.1.38693 WP_001670767.1.38740 WP_001670767.1.38773 WP_001670767.1.38781 WP_001670767.1.38797 WP_001670767.1.38830 WP_001670767.1.38857 WP_001670767.1.38881 WP_001670767.1.38882 WP_001670767.1.38895 WP_001670767.1.38898 WP_001670767.1.3891 WP_001670767.1.38942 WP_001670767.1.38995 WP_001670767.1.39003 WP_001670767.1.39038 WP_001670767.1.39048 WP_001670767.1.39055 WP_001670767.1.39059 WP_001670767.1.39065 WP_001670767.1.39075 WP_001670767.1.39082 WP_001670767.1.39112 WP_001670767.1.39113 WP_001670767.1.39128 WP_001670767.1.39136 WP_001670767.1.39140 WP_001670767.1.39146 WP_001670767.1.39183 WP_001670767.1.39197 WP_001670767.1.39229 WP_001670767.1.39265 WP_001670767.1.39275 WP_001670767.1.39311 WP_001670767.1.39312 WP_001670767.1.39385 WP_001670767.1.39395 WP_001670767.1.39405 WP_001670767.1.39414 WP_001670767.1.39420 WP_001670767.1.39449 WP_001670767.1.39466 WP_001670767.1.39471 WP_001670767.1.39497 WP_001670767.1.39503 WP_001670767.1.39512 WP_001670767.1.39553 WP_001670767.1.39556 WP_001670767.1.39576 WP_001670767.1.39584 WP_001670767.1.39609 WP_001670767.1.39614 WP_001670767.1.39629 WP_001670767.1.39632 WP_001670767.1.39722 WP_001670767.1.39723 WP_001670767.1.39724 WP_001670767.1.39763 WP_001670767.1.39808 WP_001670767.1.39862 WP_001670767.1.39921 WP_001670767.1.39953 WP_001670767.1.40008 WP_001670767.1.40017 WP_001670767.1.40025 WP_001670767.1.40031 WP_001670767.1.40072 WP_001670767.1.40073 WP_001670767.1.40081 WP_001670767.1.4011 WP_001670767.1.40111 WP_001670767.1.40155 WP_001670767.1.40158 WP_001670767.1.40171 WP_001670767.1.40205 WP_001670767.1.40208 WP_001670767.1.40224 WP_001670767.1.40229 WP_001670767.1.40240 WP_001670767.1.40254 WP_001670767.1.40257 WP_001670767.1.40258 WP_001670767.1.40259 WP_001670767.1.40284 WP_001670767.1.40292 WP_001670767.1.40305 WP_001670767.1.40311 WP_001670767.1.40341 WP_001670767.1.40374 WP_001670767.1.40380 WP_001670767.1.40395 WP_001670767.1.40465 WP_001670767.1.40492 WP_001670767.1.40493 WP_001670767.1.40508 WP_001670767.1.40528 WP_001670767.1.40533 WP_001670767.1.40577 WP_001670767.1.40583 WP_001670767.1.40605 WP_001670767.1.40622 WP_001670767.1.40648 WP_001670767.1.40688 WP_001670767.1.40693 WP_001670767.1.40695 WP_001670767.1.40710 WP_001670767.1.40722 WP_001670767.1.40745 WP_001670767.1.4075 WP_001670767.1.40771 WP_001670767.1.40788 WP_001670767.1.40849 WP_001670767.1.4087 WP_001670767.1.40877 WP_001670767.1.40910 WP_001670767.1.40930 WP_001670767.1.40935 WP_001670767.1.40973 WP_001670767.1.40979 WP_001670767.1.40996 WP_001670767.1.41017 WP_001670767.1.41018 WP_001670767.1.41048 WP_001670767.1.41050 WP_001670767.1.41086 WP_001670767.1.4109 WP_001670767.1.41091 WP_001670767.1.41116 WP_001670767.1.41128 WP_001670767.1.41192 WP_001670767.1.41225 WP_001670767.1.41226 WP_001670767.1.41265 WP_001670767.1.41277 WP_001670767.1.41279 WP_001670767.1.41299 WP_001670767.1.41308 WP_001670767.1.41310 WP_001670767.1.41345 WP_001670767.1.41375 WP_001670767.1.4141 WP_001670767.1.41427 WP_001670767.1.41434 WP_001670767.1.41438 WP_001670767.1.41440 WP_001670767.1.41468 WP_001670767.1.41516 WP_001670767.1.41528 WP_001670767.1.41554 WP_001670767.1.41572 WP_001670767.1.41591 WP_001670767.1.41593 WP_001670767.1.41610 WP_001670767.1.41628 WP_001670767.1.41662 WP_001670767.1.41688 WP_001670767.1.41690 WP_001670767.1.41708 WP_001670767.1.41724 WP_001670767.1.41735 WP_001670767.1.41761 WP_001670767.1.4178 WP_001670767.1.41789 WP_001670767.1.41799 WP_001670767.1.41802 WP_001670767.1.4184 WP_001670767.1.41859 WP_001670767.1.41862 WP_001670767.1.41877 WP_001670767.1.41882 WP_001670767.1.41897 WP_001670767.1.41904 WP_001670767.1.41911 WP_001670767.1.41931 WP_001670767.1.41938 WP_001670767.1.41949 WP_001670767.1.41978 WP_001670767.1.41979 WP_001670767.1.41985 WP_001670767.1.41994 WP_001670767.1.41998 WP_001670767.1.42009 WP_001670767.1.42098 WP_001670767.1.42104 WP_001670767.1.42109 WP_001670767.1.42136 WP_001670767.1.42156 WP_001670767.1.422 WP_001670767.1.4222 WP_001670767.1.42238 WP_001670767.1.42243 WP_001670767.1.42244 WP_001670767.1.42248 WP_001670767.1.42262 WP_001670767.1.42263 WP_001670767.1.42276 WP_001670767.1.4229 WP_001670767.1.42320 WP_001670767.1.42322 WP_001670767.1.42328 WP_001670767.1.42342 WP_001670767.1.42356 WP_001670767.1.42372 WP_001670767.1.4239 WP_001670767.1.42392 WP_001670767.1.42404 WP_001670767.1.42422 WP_001670767.1.42433 WP_001670767.1.42444 WP_001670767.1.42453 WP_001670767.1.42491 WP_001670767.1.4257 WP_001670767.1.42595 WP_001670767.1.42605 WP_001670767.1.42655 WP_001670767.1.42666 WP_001670767.1.42675 WP_001670767.1.42676 WP_001670767.1.42683 WP_001670767.1.42685 WP_001670767.1.42707 WP_001670767.1.42734 WP_001670767.1.4276 WP_001670767.1.42767 WP_001670767.1.42794 WP_001670767.1.42797 WP_001670767.1.42829 WP_001670767.1.42861 WP_001670767.1.42864 WP_001670767.1.4288 WP_001670767.1.42887 WP_001670767.1.4289 WP_001670767.1.42892 WP_001670767.1.42932 WP_001670767.1.42957 WP_001670767.1.42981 WP_001670767.1.43018 WP_001670767.1.43041 WP_001670767.1.43077 WP_001670767.1.43086 WP_001670767.1.43126 WP_001670767.1.43149 WP_001670767.1.43160 WP_001670767.1.43201 WP_001670767.1.43244 WP_001670767.1.43258 WP_001670767.1.43272 WP_001670767.1.43276 WP_001670767.1.43299 WP_001670767.1.43312 WP_001670767.1.43334 WP_001670767.1.43339 WP_001670767.1.43351 WP_001670767.1.43371 WP_001670767.1.43437 WP_001670767.1.43438 WP_001670767.1.4344 WP_001670767.1.43441 WP_001670767.1.43476 WP_001670767.1.43508 WP_001670767.1.43520 WP_001670767.1.43522 WP_001670767.1.43528 WP_001670767.1.43535 WP_001670767.1.43606 WP_001670767.1.43613 WP_001670767.1.43654 WP_001670767.1.43668 WP_001670767.1.43676 WP_001670767.1.43685 WP_001670767.1.43710 WP_001670767.1.43711 WP_001670767.1.4373 WP_001670767.1.43763 WP_001670767.1.43778 WP_001670767.1.43782 WP_001670767.1.43785 WP_001670767.1.43828 WP_001670767.1.43839 WP_001670767.1.43864 WP_001670767.1.43873 WP_001670767.1.43875 WP_001670767.1.43886 WP_001670767.1.43951 WP_001670767.1.43954 WP_001670767.1.44005 WP_001670767.1.44010 WP_001670767.1.4404 WP_001670767.1.44043 WP_001670767.1.4405 WP_001670767.1.44063 WP_001670767.1.44099 WP_001670767.1.44144 WP_001670767.1.44187 WP_001670767.1.4422 WP_001670767.1.4423 WP_001670767.1.44250 WP_001670767.1.44300 WP_001670767.1.44310 WP_001670767.1.44337 WP_001670767.1.44339 WP_001670767.1.44359 WP_001670767.1.44380 WP_001670767.1.44386 WP_001670767.1.44397 WP_001670767.1.4440 WP_001670767.1.44433 WP_001670767.1.44438 WP_001670767.1.44440 WP_001670767.1.44443 WP_001670767.1.44453 WP_001670767.1.44474 WP_001670767.1.44479 WP_001670767.1.44549 WP_001670767.1.44578 WP_001670767.1.44593 WP_001670767.1.44606 WP_001670767.1.44607 WP_001670767.1.44633 WP_001670767.1.44636 WP_001670767.1.44640 WP_001670767.1.4467 WP_001670767.1.44678 WP_001670767.1.44687 WP_001670767.1.44702 WP_001670767.1.44705 WP_001670767.1.44747 WP_001670767.1.44781 WP_001670767.1.44791 WP_001670767.1.44795 WP_001670767.1.44831 WP_001670767.1.44833 WP_001670767.1.4485 WP_001670767.1.44877 WP_001670767.1.44887 WP_001670767.1.449 WP_001670767.1.44927 WP_001670767.1.44933 WP_001670767.1.44943 WP_001670767.1.44950 WP_001670767.1.44966 WP_001670767.1.44971 WP_001670767.1.44978 WP_001670767.1.44985 WP_001670767.1.44996 WP_001670767.1.44997 WP_001670767.1.44998 WP_001670767.1.4500 WP_001670767.1.45027 WP_001670767.1.45067 WP_001670767.1.45074 WP_001670767.1.45079 WP_001670767.1.45098 WP_001670767.1.45123 WP_001670767.1.45134 WP_001670767.1.45138 WP_001670767.1.45145 WP_001670767.1.45154 WP_001670767.1.45173 WP_001670767.1.45177 WP_001670767.1.45184 WP_001670767.1.45229 WP_001670767.1.45251 WP_001670767.1.45259 WP_001670767.1.45268 WP_001670767.1.45302 WP_001670767.1.4531 WP_001670767.1.45322 WP_001670767.1.45344 WP_001670767.1.45349 WP_001670767.1.45351 WP_001670767.1.45365 WP_001670767.1.4540 WP_001670767.1.45402 WP_001670767.1.45432 WP_001670767.1.45434 WP_001670767.1.45462 WP_001670767.1.45468 WP_001670767.1.45522 WP_001670767.1.45535 WP_001670767.1.45544 WP_001670767.1.45549 WP_001670767.1.45550 WP_001670767.1.45566 WP_001670767.1.45569 WP_001670767.1.45571 WP_001670767.1.45582 WP_001670767.1.45583 WP_001670767.1.45585 WP_001670767.1.45622 WP_001670767.1.45660 WP_001670767.1.45690 WP_001670767.1.45706 WP_001670767.1.45781 WP_001670767.1.45797 WP_001670767.1.45844 WP_001670767.1.45848 WP_001670767.1.45906 WP_001670767.1.45918 WP_001670767.1.4592 WP_001670767.1.45984 WP_001670767.1.46011 WP_001670767.1.46028 WP_001670767.1.46069 WP_001670767.1.46112 WP_001670767.1.46124 WP_001670767.1.46173 WP_001670767.1.46174 WP_001670767.1.46187 WP_001670767.1.46203 WP_001670767.1.46205 WP_001670767.1.46215 WP_001670767.1.46232 WP_001670767.1.46243 WP_001670767.1.46250 WP_001670767.1.46278 WP_001670767.1.46286 WP_001670767.1.46299 WP_001670767.1.46323 WP_001670767.1.46345 WP_001670767.1.46358 WP_001670767.1.46406 WP_001670767.1.46434 WP_001670767.1.46444 WP_001670767.1.46499 WP_001670767.1.46572 WP_001670767.1.46574 WP_001670767.1.46578 WP_001670767.1.46595 WP_001670767.1.46637 WP_001670767.1.46666 WP_001670767.1.46675 WP_001670767.1.46689 WP_001670767.1.46693 WP_001670767.1.4671 WP_001670767.1.46726 WP_001670767.1.46730 WP_001670767.1.46732 WP_001670767.1.4674 WP_001670767.1.46749 WP_001670767.1.46803 WP_001670767.1.46804 WP_001670767.1.4686 WP_001670767.1.46930 WP_001670767.1.46961 WP_001670767.1.46967 WP_001670767.1.46976 WP_001670767.1.47005 WP_001670767.1.47008 WP_001670767.1.47014 WP_001670767.1.47023 WP_001670767.1.47057 WP_001670767.1.47061 WP_001670767.1.47067 WP_001670767.1.47214 WP_001670767.1.47243 WP_001670767.1.47257 WP_001670767.1.47389 WP_001670767.1.47429 WP_001670767.1.47442 WP_001670767.1.47448 WP_001670767.1.47460 WP_001670767.1.4747 WP_001670767.1.47472 WP_001670767.1.47478 WP_001670767.1.47482 WP_001670767.1.47492 WP_001670767.1.47506 WP_001670767.1.47507 WP_001670767.1.47542 WP_001670767.1.47567 WP_001670767.1.47576 WP_001670767.1.47579 WP_001670767.1.4758 WP_001670767.1.47587 WP_001670767.1.47614 WP_001670767.1.47621 WP_001670767.1.47649 WP_001670767.1.47660 WP_001670767.1.4769 WP_001670767.1.4770 WP_001670767.1.47714 WP_001670767.1.4775 WP_001670767.1.47767 WP_001670767.1.47799 WP_001670767.1.47814 WP_001670767.1.47817 WP_001670767.1.47829 WP_001670767.1.47849 WP_001670767.1.47850 WP_001670767.1.47875 WP_001670767.1.47902 WP_001670767.1.47911 WP_001670767.1.47928 WP_001670767.1.47988 WP_001670767.1.47992 WP_001670767.1.48124 WP_001670767.1.48132 WP_001670767.1.48134 WP_001670767.1.48209 WP_001670767.1.48215 WP_001670767.1.48218 WP_001670767.1.48242 WP_001670767.1.48244 WP_001670767.1.48247 WP_001670767.1.48253 WP_001670767.1.48262 WP_001670767.1.48268 WP_001670767.1.483 WP_001670767.1.48367 WP_001670767.1.48377 WP_001670767.1.4839 WP_001670767.1.48399 WP_001670767.1.48455 WP_001670767.1.48493 WP_001670767.1.48510 WP_001670767.1.48524 WP_001670767.1.4853 WP_001670767.1.48570 WP_001670767.1.48647 WP_001670767.1.48751 WP_001670767.1.48755 WP_001670767.1.48768 WP_001670767.1.48774 WP_001670767.1.48788 WP_001670767.1.48797 WP_001670767.1.48841 WP_001670767.1.4885 WP_001670767.1.48855 WP_001670767.1.48876 WP_001670767.1.48886 WP_001670767.1.48894 WP_001670767.1.48896 WP_001670767.1.48908 WP_001670767.1.48918 WP_001670767.1.48919 WP_001670767.1.48931 WP_001670767.1.48985 WP_001670767.1.49005 WP_001670767.1.49012 WP_001670767.1.49084 WP_001670767.1.49090 WP_001670767.1.49102 WP_001670767.1.49113 WP_001670767.1.49155 WP_001670767.1.49162 WP_001670767.1.49175 WP_001670767.1.49204 WP_001670767.1.49214 WP_001670767.1.49226 WP_001670767.1.49233 WP_001670767.1.49239 WP_001670767.1.49256 WP_001670767.1.49262 WP_001670767.1.49276 WP_001670767.1.49290 WP_001670767.1.49304 WP_001670767.1.49309 WP_001670767.1.49311 WP_001670767.1.49334 WP_001670767.1.49340 WP_001670767.1.49366 WP_001670767.1.49375 WP_001670767.1.49430 WP_001670767.1.49443 WP_001670767.1.49472 WP_001670767.1.49490 WP_001670767.1.49494 WP_001670767.1.49515 WP_001670767.1.49550 WP_001670767.1.49572 WP_001670767.1.49574 WP_001670767.1.49590 WP_001670767.1.49595 WP_001670767.1.49626 WP_001670767.1.49630 WP_001670767.1.49647 WP_001670767.1.49650 WP_001670767.1.49770 WP_001670767.1.49778 WP_001670767.1.49780 WP_001670767.1.4979 WP_001670767.1.49790 WP_001670767.1.49803 WP_001670767.1.49805 WP_001670767.1.49827 WP_001670767.1.49848 WP_001670767.1.49929 WP_001670767.1.49931 WP_001670767.1.50 WP_001670767.1.50003 WP_001670767.1.50007 WP_001670767.1.5009 WP_001670767.1.50128 WP_001670767.1.50153 WP_001670767.1.50161 WP_001670767.1.50198 WP_001670767.1.50211 WP_001670767.1.50238 WP_001670767.1.50239 WP_001670767.1.50251 WP_001670767.1.50285 WP_001670767.1.50332 WP_001670767.1.50349 WP_001670767.1.50374 WP_001670767.1.50376 WP_001670767.1.50386 WP_001670767.1.50389 WP_001670767.1.50404 WP_001670767.1.50449 WP_001670767.1.50469 WP_001670767.1.50480 WP_001670767.1.50497 WP_001670767.1.50517 WP_001670767.1.50529 WP_001670767.1.50563 WP_001670767.1.50565 WP_001670767.1.50576 WP_001670767.1.5058 WP_001670767.1.50593 WP_001670767.1.50652 WP_001670767.1.50676 WP_001670767.1.50684 WP_001670767.1.50750 WP_001670767.1.50769 WP_001670767.1.50774 WP_001670767.1.50777 WP_001670767.1.50800 WP_001670767.1.50804 WP_001670767.1.50808 WP_001670767.1.50811 WP_001670767.1.5088 WP_001670767.1.50882 WP_001670767.1.50905 WP_001670767.1.50908 WP_001670767.1.50918 WP_001670767.1.50941 WP_001670767.1.50954 WP_001670767.1.50960 WP_001670767.1.50999 WP_001670767.1.51014 WP_001670767.1.51022 WP_001670767.1.51036 WP_001670767.1.51066 WP_001670767.1.51117 WP_001670767.1.51131 WP_001670767.1.51139 WP_001670767.1.5114 WP_001670767.1.51162 WP_001670767.1.51178 WP_001670767.1.51179 WP_001670767.1.51182 WP_001670767.1.51186 WP_001670767.1.51224 WP_001670767.1.5125 WP_001670767.1.51285 WP_001670767.1.51308 WP_001670767.1.51331 WP_001670767.1.51338 WP_001670767.1.51356 WP_001670767.1.5138 WP_001670767.1.51394 WP_001670767.1.51412 WP_001670767.1.51414 WP_001670767.1.51451 WP_001670767.1.51464 WP_001670767.1.51487 WP_001670767.1.51488 WP_001670767.1.51502 WP_001670767.1.51506 WP_001670767.1.51514 WP_001670767.1.51518 WP_001670767.1.51555 WP_001670767.1.51594 WP_001670767.1.51611 WP_001670767.1.51613 WP_001670767.1.51615 WP_001670767.1.51634 WP_001670767.1.51642 WP_001670767.1.51649 WP_001670767.1.51686 WP_001670767.1.51700 WP_001670767.1.51704 WP_001670767.1.51764 WP_001670767.1.51810 WP_001670767.1.51831 WP_001670767.1.51841 WP_001670767.1.5185 WP_001670767.1.51888 WP_001670767.1.51900 WP_001670767.1.51910 WP_001670767.1.51911 WP_001670767.1.51914 WP_001670767.1.51930 WP_001670767.1.51932 WP_001670767.1.51989 WP_001670767.1.51994 WP_001670767.1.520 WP_001670767.1.52047 WP_001670767.1.52101 WP_001670767.1.5211 WP_001670767.1.52121 WP_001670767.1.52123 WP_001670767.1.52148 WP_001670767.1.52156 WP_001670767.1.5216 WP_001670767.1.52161 WP_001670767.1.52170 WP_001670767.1.52255 WP_001670767.1.52301 WP_001670767.1.52321 WP_001670767.1.52336 WP_001670767.1.52346 WP_001670767.1.52353 WP_001670767.1.52356 WP_001670767.1.52361 WP_001670767.1.52438 WP_001670767.1.52446 WP_001670767.1.52456 WP_001670767.1.52527 WP_001670767.1.52528 WP_001670767.1.52582 WP_001670767.1.52586 WP_001670767.1.52608 WP_001670767.1.52637 WP_001670767.1.52653 WP_001670767.1.52656 WP_001670767.1.52675 WP_001670767.1.52692 WP_001670767.1.5273 WP_001670767.1.52738 WP_001670767.1.52743 WP_001670767.1.52744 WP_001670767.1.52748 WP_001670767.1.52824 WP_001670767.1.52833 WP_001670767.1.52851 WP_001670767.1.52857 WP_001670767.1.52858 WP_001670767.1.52866 WP_001670767.1.52898 WP_001670767.1.52915 WP_001670767.1.52924 WP_001670767.1.52949 WP_001670767.1.52985 WP_001670767.1.53100 WP_001670767.1.53107 WP_001670767.1.53119 WP_001670767.1.5313 WP_001670767.1.53158 WP_001670767.1.5316 WP_001670767.1.53179 WP_001670767.1.53190 WP_001670767.1.53198 WP_001670767.1.53203 WP_001670767.1.53206 WP_001670767.1.53234 WP_001670767.1.53272 WP_001670767.1.53315 WP_001670767.1.53316 WP_001670767.1.53328 WP_001670767.1.5333 WP_001670767.1.53362 WP_001670767.1.53385 WP_001670767.1.53406 WP_001670767.1.53436 WP_001670767.1.53454 WP_001670767.1.53466 WP_001670767.1.53529 WP_001670767.1.53534 WP_001670767.1.53543 WP_001670767.1.53567 WP_001670767.1.53664 WP_001670767.1.53675 WP_001670767.1.53688 WP_001670767.1.53694 WP_001670767.1.53696 WP_001670767.1.53757 WP_001670767.1.53772 WP_001670767.1.53778 WP_001670767.1.53781 WP_001670767.1.53790 WP_001670767.1.53812 WP_001670767.1.53814 WP_001670767.1.53896 WP_001670767.1.53905 WP_001670767.1.5392 WP_001670767.1.53935 WP_001670767.1.53961 WP_001670767.1.54033 WP_001670767.1.54061 WP_001670767.1.54068 WP_001670767.1.54075 WP_001670767.1.54082 WP_001670767.1.54085 WP_001670767.1.5415 WP_001670767.1.54159 WP_001670767.1.54196 WP_001670767.1.542 WP_001670767.1.54209 WP_001670767.1.54271 WP_001670767.1.54273 WP_001670767.1.54274 WP_001670767.1.54283 WP_001670767.1.54319 WP_001670767.1.54324 WP_001670767.1.54333 WP_001670767.1.54340 WP_001670767.1.54364 WP_001670767.1.54366 WP_001670767.1.54400 WP_001670767.1.54469 WP_001670767.1.54500 WP_001670767.1.54522 WP_001670767.1.54526 WP_001670767.1.54558 WP_001670767.1.5456 WP_001670767.1.54569 WP_001670767.1.54607 WP_001670767.1.54615 WP_001670767.1.5462 WP_001670767.1.54644 WP_001670767.1.54662 WP_001670767.1.54694 WP_001670767.1.54722 WP_001670767.1.54749 WP_001670767.1.54764 WP_001670767.1.54774 WP_001670767.1.54814 WP_001670767.1.54822 WP_001670767.1.54827 WP_001670767.1.54833 WP_001670767.1.54845 WP_001670767.1.5485 WP_001670767.1.54877 WP_001670767.1.5493 WP_001670767.1.54936 WP_001670767.1.54984 WP_001670767.1.54992 WP_001670767.1.55008 WP_001670767.1.55073 WP_001670767.1.55152 WP_001670767.1.55156 WP_001670767.1.55166 WP_001670767.1.5517 WP_001670767.1.55178 WP_001670767.1.55200 WP_001670767.1.55223 WP_001670767.1.55224 WP_001670767.1.5523 WP_001670767.1.5525 WP_001670767.1.5527 WP_001670767.1.55285 WP_001670767.1.55294 WP_001670767.1.55325 WP_001670767.1.55418 WP_001670767.1.55430 WP_001670767.1.55461 WP_001670767.1.55475 WP_001670767.1.55477 WP_001670767.1.55496 WP_001670767.1.5552 WP_001670767.1.55528 WP_001670767.1.55545 WP_001670767.1.5555 WP_001670767.1.55554 WP_001670767.1.55557 WP_001670767.1.55559 WP_001670767.1.5560 WP_001670767.1.55614 WP_001670767.1.55623 WP_001670767.1.55640 WP_001670767.1.55647 WP_001670767.1.55672 WP_001670767.1.55680 WP_001670767.1.55706 WP_001670767.1.55718 WP_001670767.1.5572 WP_001670767.1.55743 WP_001670767.1.55768 WP_001670767.1.5577 WP_001670767.1.55782 WP_001670767.1.55796 WP_001670767.1.55803 WP_001670767.1.55853 WP_001670767.1.55923 WP_001670767.1.55948 WP_001670767.1.55973 WP_001670767.1.55993 WP_001670767.1.55995 WP_001670767.1.56002 WP_001670767.1.56004 WP_001670767.1.56012 WP_001670767.1.56026 WP_001670767.1.56059 WP_001670767.1.56069 WP_001670767.1.56070 WP_001670767.1.56082 WP_001670767.1.56097 WP_001670767.1.56105 WP_001670767.1.56130 WP_001670767.1.56235 WP_001670767.1.56238 WP_001670767.1.56244 WP_001670767.1.56247 WP_001670767.1.56263 WP_001670767.1.56286 WP_001670767.1.56303 WP_001670767.1.56304 WP_001670767.1.56305 WP_001670767.1.5633 WP_001670767.1.56368 WP_001670767.1.56370 WP_001670767.1.56374 WP_001670767.1.56385 WP_001670767.1.56389 WP_001670767.1.56393 WP_001670767.1.56396 WP_001670767.1.56413 WP_001670767.1.56414 WP_001670767.1.56420 WP_001670767.1.56438 WP_001670767.1.56468 WP_001670767.1.56512 WP_001670767.1.56559 WP_001670767.1.56560 WP_001670767.1.56597 WP_001670767.1.56601 WP_001670767.1.56614 WP_001670767.1.56642 WP_001670767.1.56647 WP_001670767.1.56651 WP_001670767.1.56660 WP_001670767.1.56671 WP_001670767.1.5668 WP_001670767.1.56682 WP_001670767.1.56791 WP_001670767.1.56824 WP_001670767.1.56851 WP_001670767.1.56853 WP_001670767.1.56861 WP_001670767.1.56875 WP_001670767.1.56877 WP_001670767.1.56893 WP_001670767.1.56898 WP_001670767.1.56905 WP_001670767.1.56942 WP_001670767.1.56950 WP_001670767.1.57000 WP_001670767.1.57026 WP_001670767.1.57039 WP_001670767.1.57056 WP_001670767.1.57076 WP_001670767.1.57084 WP_001670767.1.5711 WP_001670767.1.57125 WP_001670767.1.57143 WP_001670767.1.57149 WP_001670767.1.57168 WP_001670767.1.57187 WP_001670767.1.57232 WP_001670767.1.57244 WP_001670767.1.57246 WP_001670767.1.57296 WP_001670767.1.57307 WP_001670767.1.57344 WP_001670767.1.57356 WP_001670767.1.57357 WP_001670767.1.57362 WP_001670767.1.57377 WP_001670767.1.57399 WP_001670767.1.57418 WP_001670767.1.57433 WP_001670767.1.57494 WP_001670767.1.57495 WP_001670767.1.57510 WP_001670767.1.57515 WP_001670767.1.57529 WP_001670767.1.5753 WP_001670767.1.57534 WP_001670767.1.57555 WP_001670767.1.57559 WP_001670767.1.57576 WP_001670767.1.57601 WP_001670767.1.57607 WP_001670767.1.5761 WP_001670767.1.57631 WP_001670767.1.57641 WP_001670767.1.57709 WP_001670767.1.57710 WP_001670767.1.57735 WP_001670767.1.5774 WP_001670767.1.57763 WP_001670767.1.57778 WP_001670767.1.57781 WP_001670767.1.57797 WP_001670767.1.5781 WP_001670767.1.57835 WP_001670767.1.57857 WP_001670767.1.57862 WP_001670767.1.57890 WP_001670767.1.57891 WP_001670767.1.57893 WP_001670767.1.57902 WP_001670767.1.57978 WP_001670767.1.5801 WP_001670767.1.58040 WP_001670767.1.58041 WP_001670767.1.58090 WP_001670767.1.58131 WP_001670767.1.58144 WP_001670767.1.58153 WP_001670767.1.58157 WP_001670767.1.58239 WP_001670767.1.58249 WP_001670767.1.58251 WP_001670767.1.5828 WP_001670767.1.58290 WP_001670767.1.58301 WP_001670767.1.58334 WP_001670767.1.58357 WP_001670767.1.58358 WP_001670767.1.58372 WP_001670767.1.58407 WP_001670767.1.58416 WP_001670767.1.58418 WP_001670767.1.58442 WP_001670767.1.58443 WP_001670767.1.5846 WP_001670767.1.58467 WP_001670767.1.58486 WP_001670767.1.58489 WP_001670767.1.5854 WP_001670767.1.58548 WP_001670767.1.58564 WP_001670767.1.5858 WP_001670767.1.58604 WP_001670767.1.58633 WP_001670767.1.58662 WP_001670767.1.58669 WP_001670767.1.58675 WP_001670767.1.58698 WP_001670767.1.587 WP_001670767.1.58729 WP_001670767.1.58744 WP_001670767.1.58749 WP_001670767.1.58803 WP_001670767.1.58831 WP_001670767.1.58834 WP_001670767.1.58836 WP_001670767.1.5886 WP_001670767.1.58861 WP_001670767.1.58884 WP_001670767.1.58926 WP_001670767.1.58932 WP_001670767.1.59006 WP_001670767.1.59012 WP_001670767.1.59068 WP_001670767.1.59094 WP_001670767.1.59097 WP_001670767.1.59125 WP_001670767.1.59136 WP_001670767.1.59142 WP_001670767.1.59148 WP_001670767.1.59163 WP_001670767.1.59224 WP_001670767.1.59236 WP_001670767.1.59276 WP_001670767.1.5929 WP_001670767.1.59294 WP_001670767.1.59295 WP_001670767.1.59335 WP_001670767.1.59336 WP_001670767.1.59375 WP_001670767.1.59381 WP_001670767.1.59412 WP_001670767.1.59420 WP_001670767.1.59427 WP_001670767.1.59439 WP_001670767.1.59458 WP_001670767.1.59486 WP_001670767.1.59490 WP_001670767.1.59508 WP_001670767.1.59512 WP_001670767.1.5953 WP_001670767.1.59538 WP_001670767.1.59548 WP_001670767.1.59587 WP_001670767.1.59604 WP_001670767.1.59641 WP_001670767.1.59646 WP_001670767.1.59684 WP_001670767.1.59694 WP_001670767.1.59709 WP_001670767.1.59755 WP_001670767.1.59771 WP_001670767.1.5979 WP_001670767.1.59830 WP_001670767.1.59848 WP_001670767.1.59928 WP_001670767.1.59933 WP_001670767.1.59953 WP_001670767.1.59979 WP_001670767.1.60004 WP_001670767.1.60008 WP_001670767.1.60015 WP_001670767.1.60021 WP_001670767.1.60052 WP_001670767.1.60069 WP_001670767.1.60106 WP_001670767.1.60126 WP_001670767.1.60137 WP_001670767.1.60140 WP_001670767.1.60155 WP_001670767.1.60209 WP_001670767.1.60213 WP_001670767.1.60226 WP_001670767.1.60231 WP_001670767.1.60285 WP_001670767.1.60320 WP_001670767.1.6033 WP_001670767.1.60330 WP_001670767.1.60370 WP_001670767.1.60379 WP_001670767.1.60425 WP_001670767.1.60464 WP_001670767.1.60469 WP_001670767.1.60486 WP_001670767.1.60503 WP_001670767.1.6052 WP_001670767.1.60545 WP_001670767.1.60560 WP_001670767.1.60561 WP_001670767.1.60597 WP_001670767.1.60608 WP_001670767.1.60622 WP_001670767.1.60661 WP_001670767.1.60713 WP_001670767.1.60746 WP_001670767.1.60760 WP_001670767.1.60772 WP_001670767.1.60794 WP_001670767.1.608 WP_001670767.1.60809 WP_001670767.1.60838 WP_001670767.1.60851 WP_001670767.1.60855 WP_001670767.1.60857 WP_001670767.1.6086 WP_001670767.1.60863 WP_001670767.1.60866 WP_001670767.1.60874 WP_001670767.1.60897 WP_001670767.1.6090 WP_001670767.1.60919 WP_001670767.1.60926 WP_001670767.1.60941 WP_001670767.1.60976 WP_001670767.1.60990 WP_001670767.1.61078 WP_001670767.1.6108 WP_001670767.1.61087 WP_001670767.1.6114 WP_001670767.1.61146 WP_001670767.1.61184 WP_001670767.1.61200 WP_001670767.1.61201 WP_001670767.1.61218 WP_001670767.1.61232 WP_001670767.1.61233 WP_001670767.1.6129 WP_001670767.1.61296 WP_001670767.1.61309 WP_001670767.1.61381 WP_001670767.1.61417 WP_001670767.1.6143 WP_001670767.1.61434 WP_001670767.1.61497 WP_001670767.1.61501 WP_001670767.1.61509 WP_001670767.1.61519 WP_001670767.1.61574 WP_001670767.1.61582 WP_001670767.1.61594 WP_001670767.1.61595 WP_001670767.1.61609 WP_001670767.1.6164 WP_001670767.1.61662 WP_001670767.1.61667 WP_001670767.1.61671 WP_001670767.1.61694 WP_001670767.1.61712 WP_001670767.1.61714 WP_001670767.1.61730 WP_001670767.1.61732 WP_001670767.1.61737 WP_001670767.1.61743 WP_001670767.1.61857 WP_001670767.1.6190 WP_001670767.1.61908 WP_001670767.1.61918 WP_001670767.1.61952 WP_001670767.1.61968 WP_001670767.1.62007 WP_001670767.1.62020 WP_001670767.1.62025 WP_001670767.1.62063 WP_001670767.1.62076 WP_001670767.1.6209 WP_001670767.1.6210 WP_001670767.1.62108 WP_001670767.1.62120 WP_001670767.1.62122 WP_001670767.1.62142 WP_001670767.1.62144 WP_001670767.1.62158 WP_001670767.1.62184 WP_001670767.1.62195 WP_001670767.1.62201 WP_001670767.1.62204 WP_001670767.1.62210 WP_001670767.1.62219 WP_001670767.1.62222 WP_001670767.1.62241 WP_001670767.1.62245 WP_001670767.1.62257 WP_001670767.1.62271 WP_001670767.1.62304 WP_001670767.1.62310 WP_001670767.1.62339 WP_001670767.1.62344 WP_001670767.1.62361 WP_001670767.1.62364 WP_001670767.1.62374 WP_001670767.1.62403 WP_001670767.1.62404 WP_001670767.1.62412 WP_001670767.1.62486 WP_001670767.1.62488 WP_001670767.1.62522 WP_001670767.1.6253 WP_001670767.1.62564 WP_001670767.1.62570 WP_001670767.1.62619 WP_001670767.1.62677 WP_001670767.1.62693 WP_001670767.1.627 WP_001670767.1.62725 WP_001670767.1.62745 WP_001670767.1.62757 WP_001670767.1.62798 WP_001670767.1.62828 WP_001670767.1.62853 WP_001670767.1.62903 WP_001670767.1.62910 WP_001670767.1.6292 WP_001670767.1.62955 WP_001670767.1.62976 WP_001670767.1.62983 WP_001670767.1.62988 WP_001670767.1.63043 WP_001670767.1.63045 WP_001670767.1.63063 WP_001670767.1.63102 WP_001670767.1.63118 WP_001670767.1.63129 WP_001670767.1.63135 WP_001670767.1.63150 WP_001670767.1.63155 WP_001670767.1.63181 WP_001670767.1.63186 WP_001670767.1.63203 WP_001670767.1.63229 WP_001670767.1.63234 WP_001670767.1.63243 WP_001670767.1.63250 WP_001670767.1.63256 WP_001670767.1.63290 WP_001670767.1.63358 WP_001670767.1.63382 WP_001670767.1.63422 WP_001670767.1.63455 WP_001670767.1.63461 WP_001670767.1.63479 WP_001670767.1.63497 WP_001670767.1.63509 WP_001670767.1.63513 WP_001670767.1.63529 WP_001670767.1.63532 WP_001670767.1.63568 WP_001670767.1.6357 WP_001670767.1.63577 WP_001670767.1.63585 WP_001670767.1.63603 WP_001670767.1.63633 WP_001670767.1.63664 WP_001670767.1.6367 WP_001670767.1.63677 WP_001670767.1.63690 WP_001670767.1.6370 WP_001670767.1.63718 WP_001670767.1.63731 WP_001670767.1.63748 WP_001670767.1.6375 WP_001670767.1.63757 WP_001670767.1.63766 WP_001670767.1.63781 WP_001670767.1.63782 WP_001670767.1.63797 WP_001670767.1.63824 WP_001670767.1.63831 WP_001670767.1.63834 WP_001670767.1.63851 WP_001670767.1.63860 WP_001670767.1.63863 WP_001670767.1.63864 WP_001670767.1.63866 WP_001670767.1.63903 WP_001670767.1.63912 WP_001670767.1.63934 WP_001670767.1.63958 WP_001670767.1.63977 WP_001670767.1.6399 WP_001670767.1.63992 WP_001670767.1.64007 WP_001670767.1.64010 WP_001670767.1.64018 WP_001670767.1.64034 WP_001670767.1.64046 WP_001670767.1.64072 WP_001670767.1.64085 WP_001670767.1.64109 WP_001670767.1.64121 WP_001670767.1.64157 WP_001670767.1.64208 WP_001670767.1.64229 WP_001670767.1.6423 WP_001670767.1.64242 WP_001670767.1.64244 WP_001670767.1.64266 WP_001670767.1.64294 WP_001670767.1.64350 WP_001670767.1.6437 WP_001670767.1.64374 WP_001670767.1.64385 WP_001670767.1.64387 WP_001670767.1.64403 WP_001670767.1.64412 WP_001670767.1.64462 WP_001670767.1.64500 WP_001670767.1.6451 WP_001670767.1.64569 WP_001670767.1.64597 WP_001670767.1.64645 WP_001670767.1.64649 WP_001670767.1.64667 WP_001670767.1.64674 WP_001670767.1.64690 WP_001670767.1.64702 WP_001670767.1.64711 WP_001670767.1.64757 WP_001670767.1.64758 WP_001670767.1.64781 WP_001670767.1.64798 WP_001670767.1.64831 WP_001670767.1.6489 WP_001670767.1.64894 WP_001670767.1.64919 WP_001670767.1.64920 WP_001670767.1.64944 WP_001670767.1.64977 WP_001670767.1.65011 WP_001670767.1.65016 WP_001670767.1.65018 WP_001670767.1.65022 WP_001670767.1.65027 WP_001670767.1.65028 WP_001670767.1.65052 WP_001670767.1.65163 WP_001670767.1.65168 WP_001670767.1.65171 WP_001670767.1.65185 WP_001670767.1.65238 WP_001670767.1.65248 WP_001670767.1.6525 WP_001670767.1.65269 WP_001670767.1.65295 WP_001670767.1.65348 WP_001670767.1.6535 WP_001670767.1.65357 WP_001670767.1.65363 WP_001670767.1.65394 WP_001670767.1.65437 WP_001670767.1.65474 WP_001670767.1.65475 WP_001670767.1.6550 WP_001670767.1.65508 WP_001670767.1.65538 WP_001670767.1.65558 WP_001670767.1.65572 WP_001670767.1.6560 WP_001670767.1.65601 WP_001670767.1.6561 WP_001670767.1.65633 WP_001670767.1.6565 WP_001670767.1.65687 WP_001670767.1.65696 WP_001670767.1.65698 WP_001670767.1.6572 WP_001670767.1.6575 WP_001670767.1.65771 WP_001670767.1.65782 WP_001670767.1.65790 WP_001670767.1.65795 WP_001670767.1.65818 WP_001670767.1.65838 WP_001670767.1.65849 WP_001670767.1.65876 WP_001670767.1.65881 WP_001670767.1.65901 WP_001670767.1.6594 WP_001670767.1.65940 WP_001670767.1.65945 WP_001670767.1.6595 WP_001670767.1.65956 WP_001670767.1.65968 WP_001670767.1.66049 WP_001670767.1.66082 WP_001670767.1.66085 WP_001670767.1.66122 WP_001670767.1.66129 WP_001670767.1.66167 WP_001670767.1.66171 WP_001670767.1.66250 WP_001670767.1.66270 WP_001670767.1.66272 WP_001670767.1.66289 WP_001670767.1.6630 WP_001670767.1.66314 WP_001670767.1.66315 WP_001670767.1.66330 WP_001670767.1.66358 WP_001670767.1.66362 WP_001670767.1.66365 WP_001670767.1.66368 WP_001670767.1.6638 WP_001670767.1.66385 WP_001670767.1.6640 WP_001670767.1.66400 WP_001670767.1.66428 WP_001670767.1.66446 WP_001670767.1.66462 WP_001670767.1.6647 WP_001670767.1.66492 WP_001670767.1.66534 WP_001670767.1.66539 WP_001670767.1.66600 WP_001670767.1.66630 WP_001670767.1.66678 WP_001670767.1.66698 WP_001670767.1.66702 WP_001670767.1.66733 WP_001670767.1.6680 WP_001670767.1.66807 WP_001670767.1.66820 WP_001670767.1.66824 WP_001670767.1.66825 WP_001670767.1.66834 WP_001670767.1.66876 WP_001670767.1.66901 WP_001670767.1.6692 WP_001670767.1.66937 WP_001670767.1.66959 WP_001670767.1.66962 WP_001670767.1.67 WP_001670767.1.67037 WP_001670767.1.67045 WP_001670767.1.67075 WP_001670767.1.6710 WP_001670767.1.67100 WP_001670767.1.67173 WP_001670767.1.67175 WP_001670767.1.67181 WP_001670767.1.67184 WP_001670767.1.67228 WP_001670767.1.67235 WP_001670767.1.67268 WP_001670767.1.67279 WP_001670767.1.67288 WP_001670767.1.67347 WP_001670767.1.67374 WP_001670767.1.6739 WP_001670767.1.67405 WP_001670767.1.67424 WP_001670767.1.67465 WP_001670767.1.67552 WP_001670767.1.6760 WP_001670767.1.67617 WP_001670767.1.67633 WP_001670767.1.67637 WP_001670767.1.67682 WP_001670767.1.67707 WP_001670767.1.67731 WP_001670767.1.67772 WP_001670767.1.67776 WP_001670767.1.67803 WP_001670767.1.67814 WP_001670767.1.6782 WP_001670767.1.67825 WP_001670767.1.67827 WP_001670767.1.6785 WP_001670767.1.67887 WP_001670767.1.67905 WP_001670767.1.67924 WP_001670767.1.67932 WP_001670767.1.67942 WP_001670767.1.67969 WP_001670767.1.67970 WP_001670767.1.67977 WP_001670767.1.67988 WP_001670767.1.68036 WP_001670767.1.68073 WP_001670767.1.6809 WP_001670767.1.68115 WP_001670767.1.68140 WP_001670767.1.68147 WP_001670767.1.68159 WP_001670767.1.68201 WP_001670767.1.68206 WP_001670767.1.68210 WP_001670767.1.6827 WP_001670767.1.68275 WP_001670767.1.6833 WP_001670767.1.68401 WP_001670767.1.68477 WP_001670767.1.68478 WP_001670767.1.6849 WP_001670767.1.685 WP_001670767.1.68532 WP_001670767.1.68547 WP_001670767.1.6857 WP_001670767.1.6858 WP_001670767.1.68589 WP_001670767.1.68591 WP_001670767.1.68629 WP_001670767.1.68652 WP_001670767.1.68655 WP_001670767.1.68656 WP_001670767.1.68658 WP_001670767.1.68677 WP_001670767.1.6869 WP_001670767.1.68690 WP_001670767.1.6875 WP_001670767.1.68778 WP_001670767.1.68787 WP_001670767.1.6879 WP_001670767.1.68816 WP_001670767.1.68818 WP_001670767.1.6882 WP_001670767.1.6883 WP_001670767.1.68893 WP_001670767.1.68894 WP_001670767.1.68895 WP_001670767.1.68928 WP_001670767.1.68958 WP_001670767.1.68975 WP_001670767.1.68999 WP_001670767.1.69001 WP_001670767.1.69006 WP_001670767.1.69011 WP_001670767.1.69029 WP_001670767.1.6904 WP_001670767.1.6905 WP_001670767.1.69058 WP_001670767.1.6907 WP_001670767.1.69080 WP_001670767.1.69086 WP_001670767.1.6913 WP_001670767.1.69131 WP_001670767.1.69139 WP_001670767.1.69146 WP_001670767.1.69151 WP_001670767.1.69236 WP_001670767.1.69255 WP_001670767.1.69273 WP_001670767.1.69288 WP_001670767.1.69296 WP_001670767.1.69320 WP_001670767.1.69346 WP_001670767.1.69357 WP_001670767.1.69371 WP_001670767.1.69397 WP_001670767.1.69433 WP_001670767.1.69465 WP_001670767.1.69485 WP_001670767.1.69515 WP_001670767.1.6954 WP_001670767.1.69554 WP_001670767.1.69564 WP_001670767.1.69575 WP_001670767.1.69588 WP_001670767.1.69592 WP_001670767.1.69597 WP_001670767.1.69616 WP_001670767.1.69636 WP_001670767.1.69644 WP_001670767.1.69696 WP_001670767.1.69704 WP_001670767.1.69710 WP_001670767.1.69754 WP_001670767.1.69758 WP_001670767.1.69760 WP_001670767.1.69767 WP_001670767.1.69785 WP_001670767.1.69787 WP_001670767.1.69790 WP_001670767.1.69807 WP_001670767.1.69808 WP_001670767.1.69817 WP_001670767.1.69839 WP_001670767.1.69848 WP_001670767.1.69890 WP_001670767.1.69965 WP_001670767.1.69975 WP_001670767.1.69977 WP_001670767.1.69982 WP_001670767.1.70003 WP_001670767.1.70028 WP_001670767.1.70047 WP_001670767.1.70087 WP_001670767.1.70088 WP_001670767.1.7010 WP_001670767.1.7014 WP_001670767.1.7016 WP_001670767.1.70169 WP_001670767.1.70183 WP_001670767.1.7021 WP_001670767.1.70241 WP_001670767.1.70248 WP_001670767.1.70269 WP_001670767.1.70272 WP_001670767.1.70281 WP_001670767.1.70289 WP_001670767.1.70303 WP_001670767.1.70321 WP_001670767.1.70326 WP_001670767.1.70327 WP_001670767.1.70355 WP_001670767.1.7044 WP_001670767.1.70440 WP_001670767.1.70447 WP_001670767.1.70485 WP_001670767.1.70488 WP_001670767.1.70491 WP_001670767.1.70523 WP_001670767.1.70531 WP_001670767.1.70547 WP_001670767.1.7055 WP_001670767.1.70580 WP_001670767.1.70596 WP_001670767.1.7060 WP_001670767.1.70643 WP_001670767.1.70644 WP_001670767.1.70662 WP_001670767.1.70678 WP_001670767.1.70685 WP_001670767.1.70712 WP_001670767.1.70732 WP_001670767.1.70733 WP_001670767.1.70761 WP_001670767.1.70785 WP_001670767.1.70792 WP_001670767.1.70797 WP_001670767.1.70837 WP_001670767.1.70869 WP_001670767.1.70883 WP_001670767.1.70899 WP_001670767.1.70914 WP_001670767.1.70922 WP_001670767.1.70929 WP_001670767.1.7093 WP_001670767.1.70948 WP_001670767.1.70959 WP_001670767.1.70969 WP_001670767.1.70977 WP_001670767.1.70985 WP_001670767.1.70986 WP_001670767.1.71007 WP_001670767.1.71010 WP_001670767.1.71023 WP_001670767.1.71069 WP_001670767.1.71088 WP_001670767.1.7110 WP_001670767.1.71116 WP_001670767.1.71120 WP_001670767.1.71146 WP_001670767.1.71150 WP_001670767.1.71165 WP_001670767.1.71171 WP_001670767.1.71172 WP_001670767.1.71184 WP_001670767.1.71188 WP_001670767.1.71201 WP_001670767.1.71202 WP_001670767.1.71243 WP_001670767.1.71248 WP_001670767.1.71268 WP_001670767.1.71305 WP_001670767.1.71306 WP_001670767.1.71337 WP_001670767.1.7134 WP_001670767.1.71363 WP_001670767.1.71368 WP_001670767.1.714 WP_001670767.1.71401 WP_001670767.1.71407 WP_001670767.1.71418 WP_001670767.1.7142 WP_001670767.1.71446 WP_001670767.1.71450 WP_001670767.1.71452 WP_001670767.1.71481 WP_001670767.1.71583 WP_001670767.1.71600 WP_001670767.1.71626 WP_001670767.1.71636 WP_001670767.1.71649 WP_001670767.1.71656 WP_001670767.1.71667 WP_001670767.1.71691 WP_001670767.1.71702 WP_001670767.1.7174 WP_001670767.1.71746 WP_001670767.1.71750 WP_001670767.1.71756 WP_001670767.1.71798 WP_001670767.1.71845 WP_001670767.1.71848 WP_001670767.1.71881 WP_001670767.1.71908 WP_001670767.1.71923 WP_001670767.1.71929 WP_001670767.1.71941 WP_001670767.1.71952 WP_001670767.1.71973 WP_001670767.1.71979 WP_001670767.1.71984 WP_001670767.1.720 WP_001670767.1.72065 WP_001670767.1.72068 WP_001670767.1.72100 WP_001670767.1.72105 WP_001670767.1.72107 WP_001670767.1.72119 WP_001670767.1.72121 WP_001670767.1.72182 WP_001670767.1.72188 WP_001670767.1.72190 WP_001670767.1.72203 WP_001670767.1.72220 WP_001670767.1.72221 WP_001670767.1.72226 WP_001670767.1.72234 WP_001670767.1.72243 WP_001670767.1.72254 WP_001670767.1.72277 WP_001670767.1.72281 WP_001670767.1.72283 WP_001670767.1.72300 WP_001670767.1.72307 WP_001670767.1.72325 WP_001670767.1.72339 WP_001670767.1.72351 WP_001670767.1.72372 WP_001670767.1.72376 WP_001670767.1.72382 WP_001670767.1.72403 WP_001670767.1.72412 WP_001670767.1.7243 WP_001670767.1.72438 WP_001670767.1.72470 WP_001670767.1.72532 WP_001670767.1.72594 WP_001670767.1.72602 WP_001670767.1.72625 WP_001670767.1.72629 WP_001670767.1.72642 WP_001670767.1.72671 WP_001670767.1.72689 WP_001670767.1.72716 WP_001670767.1.72718 WP_001670767.1.72728 WP_001670767.1.72793 WP_001670767.1.72797 WP_001670767.1.72827 WP_001670767.1.72850 WP_001670767.1.72865 WP_001670767.1.72871 WP_001670767.1.72872 WP_001670767.1.72887 WP_001670767.1.72892 WP_001670767.1.72894 WP_001670767.1.72897 WP_001670767.1.72944 WP_001670767.1.72946 WP_001670767.1.7295 WP_001670767.1.72968 WP_001670767.1.72975 WP_001670767.1.7304 WP_001670767.1.73062 WP_001670767.1.73068 WP_001670767.1.73102 WP_001670767.1.73125 WP_001670767.1.73144 WP_001670767.1.7315 WP_001670767.1.73164 WP_001670767.1.73200 WP_001670767.1.73270 WP_001670767.1.73328 WP_001670767.1.7334 WP_001670767.1.73362 WP_001670767.1.73377 WP_001670767.1.73379 WP_001670767.1.7341 WP_001670767.1.73461 WP_001670767.1.73481 WP_001670767.1.73535 WP_001670767.1.7356 WP_001670767.1.73561 WP_001670767.1.73581 WP_001670767.1.73596 WP_001670767.1.73617 WP_001670767.1.73667 WP_001670767.1.73669 WP_001670767.1.73701 WP_001670767.1.73708 WP_001670767.1.7374 WP_001670767.1.73753 WP_001670767.1.73758 WP_001670767.1.73764 WP_001670767.1.73794 WP_001670767.1.73804 WP_001670767.1.73831 WP_001670767.1.73847 WP_001670767.1.7386 WP_001670767.1.7387 WP_001670767.1.73901 WP_001670767.1.73924 WP_001670767.1.73926 WP_001670767.1.7394 WP_001670767.1.73945 WP_001670767.1.73956 WP_001670767.1.73958 WP_001670767.1.73965 WP_001670767.1.74028 WP_001670767.1.74029 WP_001670767.1.74040 WP_001670767.1.74049 WP_001670767.1.7405 WP_001670767.1.74089 WP_001670767.1.74117 WP_001670767.1.74174 WP_001670767.1.74181 WP_001670767.1.74191 WP_001670767.1.74207 WP_001670767.1.74228 WP_001670767.1.74248 WP_001670767.1.743 WP_001670767.1.74300 WP_001670767.1.74379 WP_001670767.1.74402 WP_001670767.1.74410 WP_001670767.1.74414 WP_001670767.1.74418 WP_001670767.1.74422 WP_001670767.1.74428 WP_001670767.1.7444 WP_001670767.1.74454 WP_001670767.1.74466 WP_001670767.1.74469 WP_001670767.1.74481 WP_001670767.1.745 WP_001670767.1.74500 WP_001670767.1.74529 WP_001670767.1.74545 WP_001670767.1.74570 WP_001670767.1.74578 WP_001670767.1.7458 WP_001670767.1.74620 WP_001670767.1.74632 WP_001670767.1.74639 WP_001670767.1.74644 WP_001670767.1.74661 WP_001670767.1.74702 WP_001670767.1.74741 WP_001670767.1.74745 WP_001670767.1.74757 WP_001670767.1.74806 WP_001670767.1.74826 WP_001670767.1.74876 WP_001670767.1.74884 WP_001670767.1.7491 WP_001670767.1.74946 WP_001670767.1.74972 WP_001670767.1.74992 WP_001670767.1.74996 WP_001670767.1.75009 WP_001670767.1.75051 WP_001670767.1.75056 WP_001670767.1.75058 WP_001670767.1.75129 WP_001670767.1.75134 WP_001670767.1.75148 WP_001670767.1.75159 WP_001670767.1.75180 WP_001670767.1.75187 WP_001670767.1.75288 WP_001670767.1.75301 WP_001670767.1.7531 WP_001670767.1.75334 WP_001670767.1.75362 WP_001670767.1.75371 WP_001670767.1.75385 WP_001670767.1.75392 WP_001670767.1.75400 WP_001670767.1.75402 WP_001670767.1.75450 WP_001670767.1.7558 WP_001670767.1.75607 WP_001670767.1.75609 WP_001670767.1.75664 WP_001670767.1.75703 WP_001670767.1.75716 WP_001670767.1.75740 WP_001670767.1.75751 WP_001670767.1.75760 WP_001670767.1.75764 WP_001670767.1.75793 WP_001670767.1.75794 WP_001670767.1.75810 WP_001670767.1.75828 WP_001670767.1.75837 WP_001670767.1.75863 WP_001670767.1.75873 WP_001670767.1.75874 WP_001670767.1.75884 WP_001670767.1.75902 WP_001670767.1.75932 WP_001670767.1.75945 WP_001670767.1.75957 WP_001670767.1.76 WP_001670767.1.76020 WP_001670767.1.76024 WP_001670767.1.76097 WP_001670767.1.76108 WP_001670767.1.76137 WP_001670767.1.76156 WP_001670767.1.76162 WP_001670767.1.76164 WP_001670767.1.76186 WP_001670767.1.76197 WP_001670767.1.76208 WP_001670767.1.76252 WP_001670767.1.7629 WP_001670767.1.76301 WP_001670767.1.76327 WP_001670767.1.76345 WP_001670767.1.76346 WP_001670767.1.76364 WP_001670767.1.76434 WP_001670767.1.76445 WP_001670767.1.76451 WP_001670767.1.76471 WP_001670767.1.76495 WP_001670767.1.76529 WP_001670767.1.76532 WP_001670767.1.76548 WP_001670767.1.7657 WP_001670767.1.76576 WP_001670767.1.7660 WP_001670767.1.76611 WP_001670767.1.76673 WP_001670767.1.76706 WP_001670767.1.7672 WP_001670767.1.76721 WP_001670767.1.76724 WP_001670767.1.76738 WP_001670767.1.76756 WP_001670767.1.76760 WP_001670767.1.76776 WP_001670767.1.76799 WP_001670767.1.76806 WP_001670767.1.7684 WP_001670767.1.76866 WP_001670767.1.76875 WP_001670767.1.76880 WP_001670767.1.76899 WP_001670767.1.76913 WP_001670767.1.76968 WP_001670767.1.77017 WP_001670767.1.77033 WP_001670767.1.77038 WP_001670767.1.77047 WP_001670767.1.77067 WP_001670767.1.77080 WP_001670767.1.7712 WP_001670767.1.77177 WP_001670767.1.77180 WP_001670767.1.77184 WP_001670767.1.77193 WP_001670767.1.77241 WP_001670767.1.77244 WP_001670767.1.77267 WP_001670767.1.77271 WP_001670767.1.77292 WP_001670767.1.77306 WP_001670767.1.77349 WP_001670767.1.77356 WP_001670767.1.77390 WP_001670767.1.77414 WP_001670767.1.77431 WP_001670767.1.77436 WP_001670767.1.77440 WP_001670767.1.77475 WP_001670767.1.77496 WP_001670767.1.77514 WP_001670767.1.77529 WP_001670767.1.77543 WP_001670767.1.77549 WP_001670767.1.77555 WP_001670767.1.77565 WP_001670767.1.77575 WP_001670767.1.77596 WP_001670767.1.77629 WP_001670767.1.77653 WP_001670767.1.77692 WP_001670767.1.77710 WP_001670767.1.77729 WP_001670767.1.77754 WP_001670767.1.77761 WP_001670767.1.7782 WP_001670767.1.7784 WP_001670767.1.77846 WP_001670767.1.77851 WP_001670767.1.77871 WP_001670767.1.77898 WP_001670767.1.77918 WP_001670767.1.7792 WP_001670767.1.7793 WP_001670767.1.77951 WP_001670767.1.77971 WP_001670767.1.77983 WP_001670767.1.77987 WP_001670767.1.77989 WP_001670767.1.78 WP_001670767.1.78016 WP_001670767.1.7802 WP_001670767.1.78026 WP_001670767.1.78033 WP_001670767.1.78051 WP_001670767.1.78053 WP_001670767.1.78076 WP_001670767.1.78096 WP_001670767.1.78100 WP_001670767.1.78110 WP_001670767.1.78120 WP_001670767.1.7814 WP_001670767.1.78168 WP_001670767.1.78170 WP_001670767.1.78180 WP_001670767.1.78201 WP_001670767.1.78245 WP_001670767.1.78259 WP_001670767.1.78301 WP_001670767.1.78352 WP_001670767.1.78366 WP_001670767.1.78372 WP_001670767.1.78407 WP_001670767.1.78443 WP_001670767.1.78495 WP_001670767.1.78496 WP_001670767.1.78501 WP_001670767.1.78502 WP_001670767.1.78602 WP_001670767.1.78603 WP_001670767.1.7861 WP_001670767.1.78618 WP_001670767.1.78632 WP_001670767.1.78658 WP_001670767.1.78673 WP_001670767.1.78697 WP_001670767.1.78734 WP_001670767.1.78735 WP_001670767.1.78738 WP_001670767.1.7877 WP_001670767.1.78771 WP_001670767.1.78789 WP_001670767.1.78802 WP_001670767.1.78815 WP_001670767.1.78830 WP_001670767.1.78835 WP_001670767.1.78838 WP_001670767.1.78862 WP_001670767.1.78871 WP_001670767.1.78874 WP_001670767.1.78877 WP_001670767.1.78881 WP_001670767.1.78896 WP_001670767.1.7891 WP_001670767.1.78913 WP_001670767.1.78918 WP_001670767.1.78928 WP_001670767.1.7893 WP_001670767.1.78930 WP_001670767.1.78951 WP_001670767.1.78959 WP_001670767.1.79011 WP_001670767.1.79032 WP_001670767.1.79081 WP_001670767.1.79099 WP_001670767.1.79140 WP_001670767.1.79151 WP_001670767.1.79167 WP_001670767.1.79189 WP_001670767.1.79203 WP_001670767.1.79235 WP_001670767.1.79289 WP_001670767.1.79297 WP_001670767.1.79302 WP_001670767.1.79335 WP_001670767.1.79370 WP_001670767.1.794 WP_001670767.1.79427 WP_001670767.1.79462 WP_001670767.1.79466 WP_001670767.1.79468 WP_001670767.1.79472 WP_001670767.1.79495 WP_001670767.1.79529 WP_001670767.1.79531 WP_001670767.1.7956 WP_001670767.1.79570 WP_001670767.1.79580 WP_001670767.1.79586 WP_001670767.1.79635 WP_001670767.1.7964 WP_001670767.1.79642 WP_001670767.1.79645 WP_001670767.1.79659 WP_001670767.1.79668 WP_001670767.1.79708 WP_001670767.1.7972 WP_001670767.1.79734 WP_001670767.1.79738 WP_001670767.1.79757 WP_001670767.1.79778 WP_001670767.1.7979 WP_001670767.1.7982 WP_001670767.1.79832 WP_001670767.1.79845 WP_001670767.1.79867 WP_001670767.1.79892 WP_001670767.1.7991 WP_001670767.1.79910 WP_001670767.1.79914 WP_001670767.1.79929 WP_001670767.1.79934 WP_001670767.1.7994 WP_001670767.1.79942 WP_001670767.1.79945 WP_001670767.1.79951 WP_001670767.1.79966 WP_001670767.1.79974 WP_001670767.1.79977 WP_001670767.1.79996 WP_001670767.1.80045 WP_001670767.1.80077 WP_001670767.1.80137 WP_001670767.1.80182 WP_001670767.1.80229 WP_001670767.1.80236 WP_001670767.1.8024 WP_001670767.1.80249 WP_001670767.1.80250 WP_001670767.1.80254 WP_001670767.1.80293 WP_001670767.1.80296 WP_001670767.1.80307 WP_001670767.1.80366 WP_001670767.1.80380 WP_001670767.1.80441 WP_001670767.1.80443 WP_001670767.1.80448 WP_001670767.1.80473 WP_001670767.1.80479 WP_001670767.1.80480 WP_001670767.1.80496 WP_001670767.1.80529 WP_001670767.1.80542 WP_001670767.1.80586 WP_001670767.1.80609 WP_001670767.1.80638 WP_001670767.1.80651 WP_001670767.1.80667 WP_001670767.1.80674 WP_001670767.1.80707 WP_001670767.1.80723 WP_001670767.1.80750 WP_001670767.1.80757 WP_001670767.1.80760 WP_001670767.1.80780 WP_001670767.1.80803 WP_001670767.1.80819 WP_001670767.1.80827 WP_001670767.1.80831 WP_001670767.1.80840 WP_001670767.1.80850 WP_001670767.1.80857 WP_001670767.1.80868 WP_001670767.1.80874 WP_001670767.1.80876 WP_001670767.1.80881 WP_001670767.1.80913 WP_001670767.1.80927 WP_001670767.1.80939 WP_001670767.1.80959 WP_001670767.1.8096 WP_001670767.1.80973 WP_001670767.1.81037 WP_001670767.1.81041 WP_001670767.1.8106 WP_001670767.1.81067 WP_001670767.1.81069 WP_001670767.1.81107 WP_001670767.1.81109 WP_001670767.1.81110 WP_001670767.1.81118 WP_001670767.1.81149 WP_001670767.1.81175 WP_001670767.1.8119 WP_001670767.1.81193 WP_001670767.1.81197 WP_001670767.1.81225 WP_001670767.1.81231 WP_001670767.1.8127 WP_001670767.1.81275 WP_001670767.1.8130 WP_001670767.1.81302 WP_001670767.1.81305 WP_001670767.1.81320 WP_001670767.1.81321 WP_001670767.1.81328 WP_001670767.1.8134 WP_001670767.1.81354 WP_001670767.1.81388 WP_001670767.1.81404 WP_001670767.1.81409 WP_001670767.1.81410 WP_001670767.1.81425 WP_001670767.1.81455 WP_001670767.1.81472 WP_001670767.1.81504 WP_001670767.1.81528 WP_001670767.1.81548 WP_001670767.1.81568 WP_001670767.1.81667 WP_001670767.1.81668 WP_001670767.1.8168 WP_001670767.1.81735 WP_001670767.1.81736 WP_001670767.1.81743 WP_001670767.1.81746 WP_001670767.1.81750 WP_001670767.1.81760 WP_001670767.1.81768 WP_001670767.1.81785 WP_001670767.1.81795 WP_001670767.1.81798 WP_001670767.1.81941 WP_001670767.1.81965 WP_001670767.1.81974 WP_001670767.1.81977 WP_001670767.1.81995 WP_001670767.1.82037 WP_001670767.1.82099 WP_001670767.1.82141 WP_001670767.1.82149 WP_001670767.1.82192 WP_001670767.1.82232 WP_001670767.1.82258 WP_001670767.1.82269 WP_001670767.1.82337 WP_001670767.1.82347 WP_001670767.1.82352 WP_001670767.1.8236 WP_001670767.1.82369 WP_001670767.1.82395 WP_001670767.1.82401 WP_001670767.1.82420 WP_001670767.1.82434 WP_001670767.1.82464 WP_001670767.1.8247 WP_001670767.1.82474 WP_001670767.1.82479 WP_001670767.1.82503 WP_001670767.1.82515 WP_001670767.1.82530 WP_001670767.1.82562 WP_001670767.1.82569 WP_001670767.1.82570 WP_001670767.1.82584 WP_001670767.1.82636 WP_001670767.1.82637 WP_001670767.1.82648 WP_001670767.1.82692 WP_001670767.1.82761 WP_001670767.1.82763 WP_001670767.1.8282 WP_001670767.1.82841 WP_001670767.1.82843 WP_001670767.1.82867 WP_001670767.1.82886 WP_001670767.1.82895 WP_001670767.1.82899 WP_001670767.1.82908 WP_001670767.1.82937 WP_001670767.1.82944 WP_001670767.1.82946 WP_001670767.1.82956 WP_001670767.1.82964 WP_001670767.1.82992 WP_001670767.1.83005 WP_001670767.1.83006 WP_001670767.1.83061 WP_001670767.1.83092 WP_001670767.1.83119 WP_001670767.1.83128 WP_001670767.1.83163 WP_001670767.1.83204 WP_001670767.1.83221 WP_001670767.1.83247 WP_001670767.1.83252 WP_001670767.1.83258 WP_001670767.1.83280 WP_001670767.1.83301 WP_001670767.1.83305 WP_001670767.1.83331 WP_001670767.1.83354 WP_001670767.1.83356 WP_001670767.1.83360 WP_001670767.1.83365 WP_001670767.1.83378 WP_001670767.1.83382 WP_001670767.1.83388 WP_001670767.1.83407 WP_001670767.1.83491 WP_001670767.1.83510 WP_001670767.1.83516 WP_001670767.1.83523 WP_001670767.1.8354 WP_001670767.1.83558 WP_001670767.1.83572 WP_001670767.1.83650 WP_001670767.1.83651 WP_001670767.1.83710 WP_001670767.1.83721 WP_001670767.1.83739 WP_001670767.1.83759 WP_001670767.1.83760 WP_001670767.1.83806 WP_001670767.1.83854 WP_001670767.1.83897 WP_001670767.1.83960 WP_001670767.1.83979 WP_001670767.1.8399 WP_001670767.1.83995 WP_001670767.1.84000 WP_001670767.1.84001 WP_001670767.1.84011 WP_001670767.1.84075 WP_001670767.1.84077 WP_001670767.1.84083 WP_001670767.1.84086 WP_001670767.1.84100 WP_001670767.1.84103 WP_001670767.1.84106 WP_001670767.1.84115 WP_001670767.1.84154 WP_001670767.1.84168 WP_001670767.1.84198 WP_001670767.1.84205 WP_001670767.1.84209 WP_001670767.1.84229 WP_001670767.1.8425 WP_001670767.1.84283 WP_001670767.1.84291 WP_001670767.1.84300 WP_001670767.1.84325 WP_001670767.1.84355 WP_001670767.1.84373 WP_001670767.1.84392 WP_001670767.1.84397 WP_001670767.1.84403 WP_001670767.1.8441 WP_001670767.1.84459 WP_001670767.1.84461 WP_001670767.1.84475 WP_001670767.1.84497 WP_001670767.1.84515 WP_001670767.1.84523 WP_001670767.1.84532 WP_001670767.1.84572 WP_001670767.1.84598 WP_001670767.1.84644 WP_001670767.1.84659 WP_001670767.1.84683 WP_001670767.1.84693 WP_001670767.1.84711 WP_001670767.1.84721 WP_001670767.1.84745 WP_001670767.1.84814 WP_001670767.1.84872 WP_001670767.1.84876 WP_001670767.1.84879 WP_001670767.1.84899 WP_001670767.1.849 WP_001670767.1.8497 WP_001670767.1.84983 WP_001670767.1.850 WP_001670767.1.85014 WP_001670767.1.85031 WP_001670767.1.85040 WP_001670767.1.85079 WP_001670767.1.85094 WP_001670767.1.85120 WP_001670767.1.85126 WP_001670767.1.85134 WP_001670767.1.85147 WP_001670767.1.85178 WP_001670767.1.85190 WP_001670767.1.85192 WP_001670767.1.85217 WP_001670767.1.8526 WP_001670767.1.85271 WP_001670767.1.85301 WP_001670767.1.8533 WP_001670767.1.8537 WP_001670767.1.85408 WP_001670767.1.85433 WP_001670767.1.8545 WP_001670767.1.85456 WP_001670767.1.85469 WP_001670767.1.85481 WP_001670767.1.85483 WP_001670767.1.8552 WP_001670767.1.85541 WP_001670767.1.8556 WP_001670767.1.85568 WP_001670767.1.85615 WP_001670767.1.85617 WP_001670767.1.85663 WP_001670767.1.85671 WP_001670767.1.85672 WP_001670767.1.85675 WP_001670767.1.85723 WP_001670767.1.85742 WP_001670767.1.85759 WP_001670767.1.85777 WP_001670767.1.85780 WP_001670767.1.85784 WP_001670767.1.85797 WP_001670767.1.85854 WP_001670767.1.85855 WP_001670767.1.85864 WP_001670767.1.85886 WP_001670767.1.85900 WP_001670767.1.85904 WP_001670767.1.8591 WP_001670767.1.85943 WP_001670767.1.85982 WP_001670767.1.86007 WP_001670767.1.86010 WP_001670767.1.86017 WP_001670767.1.86043 WP_001670767.1.86092 WP_001670767.1.86138 WP_001670767.1.86157 WP_001670767.1.86159 WP_001670767.1.8616 WP_001670767.1.86173 WP_001670767.1.86206 WP_001670767.1.86224 WP_001670767.1.86240 WP_001670767.1.86259 WP_001670767.1.86284 WP_001670767.1.86285 WP_001670767.1.86306 WP_001670767.1.86310 WP_001670767.1.86316 WP_001670767.1.86335 WP_001670767.1.86347 WP_001670767.1.86356 WP_001670767.1.86380 WP_001670767.1.86389 WP_001670767.1.86442 WP_001670767.1.86450 WP_001670767.1.86453 WP_001670767.1.86466 WP_001670767.1.86469 WP_001670767.1.8647 WP_001670767.1.86514 WP_001670767.1.86580 WP_001670767.1.86588 WP_001670767.1.86593 WP_001670767.1.86601 WP_001670767.1.86610 WP_001670767.1.86634 WP_001670767.1.86656 WP_001670767.1.86658 WP_001670767.1.86661 WP_001670767.1.86676 WP_001670767.1.86699 WP_001670767.1.8671 WP_001670767.1.8672 WP_001670767.1.86735 WP_001670767.1.86744 WP_001670767.1.8678 WP_001670767.1.86807 WP_001670767.1.86810 WP_001670767.1.8684 WP_001670767.1.86860 WP_001670767.1.86895 WP_001670767.1.86902 WP_001670767.1.86906 WP_001670767.1.8691 WP_001670767.1.86915 WP_001670767.1.86921 WP_001670767.1.86982 WP_001670767.1.87038 WP_001670767.1.87051 WP_001670767.1.87095 WP_001670767.1.87143 WP_001670767.1.87148 WP_001670767.1.87187 WP_001670767.1.87219 WP_001670767.1.8722 WP_001670767.1.87220 WP_001670767.1.87265 WP_001670767.1.87276 WP_001670767.1.87282 WP_001670767.1.87283 WP_001670767.1.87323 WP_001670767.1.87346 WP_001670767.1.8736 WP_001670767.1.87365 WP_001670767.1.87370 WP_001670767.1.87376 WP_001670767.1.87460 WP_001670767.1.87484 WP_001670767.1.87493 WP_001670767.1.87500 WP_001670767.1.87552 WP_001670767.1.87583 WP_001670767.1.87584 WP_001670767.1.87618 WP_001670767.1.87626 WP_001670767.1.87651 WP_001670767.1.8767 WP_001670767.1.87687 WP_001670767.1.87695 WP_001670767.1.87712 WP_001670767.1.87760 WP_001670767.1.87779 WP_001670767.1.87813 WP_001670767.1.87875 WP_001670767.1.87891 WP_001670767.1.87899 WP_001670767.1.87905 WP_001670767.1.87936 WP_001670767.1.8800 WP_001670767.1.88014 WP_001670767.1.88019 WP_001670767.1.88052 WP_001670767.1.8809 WP_001670767.1.88092 WP_001670767.1.88136 WP_001670767.1.88165 WP_001670767.1.88174 WP_001670767.1.88185 WP_001670767.1.88214 WP_001670767.1.88222 WP_001670767.1.88275 WP_001670767.1.88291 WP_001670767.1.88293 WP_001670767.1.88303 WP_001670767.1.88356 WP_001670767.1.8837 WP_001670767.1.88393 WP_001670767.1.88423 WP_001670767.1.88474 WP_001670767.1.88483 WP_001670767.1.8849 WP_001670767.1.88508 WP_001670767.1.88597 WP_001670767.1.88609 WP_001670767.1.88620 WP_001670767.1.88624 WP_001670767.1.88651 WP_001670767.1.88675 WP_001670767.1.88683 WP_001670767.1.88698 WP_001670767.1.88703 WP_001670767.1.88731 WP_001670767.1.88792 WP_001670767.1.88817 WP_001670767.1.88845 WP_001670767.1.88854 WP_001670767.1.88902 WP_001670767.1.8891 WP_001670767.1.88942 WP_001670767.1.88957 WP_001670767.1.88966 WP_001670767.1.88967 WP_001670767.1.88968 WP_001670767.1.88970 WP_001670767.1.88980 WP_001670767.1.88981 WP_001670767.1.88995 WP_001670767.1.88998 WP_001670767.1.89054 WP_001670767.1.89114 WP_001670767.1.89116 WP_001670767.1.89119 WP_001670767.1.89120 WP_001670767.1.89138 WP_001670767.1.89174 WP_001670767.1.89177 WP_001670767.1.89188 WP_001670767.1.89215 WP_001670767.1.89221 WP_001670767.1.89291 WP_001670767.1.89304 WP_001670767.1.89311 WP_001670767.1.89355 WP_001670767.1.89362 WP_001670767.1.89408 WP_001670767.1.89425 WP_001670767.1.89452 WP_001670767.1.89462 WP_001670767.1.89512 WP_001670767.1.89527 WP_001670767.1.89570 WP_001670767.1.8958 WP_001670767.1.89604 WP_001670767.1.89606 WP_001670767.1.8961 WP_001670767.1.89622 WP_001670767.1.89632 WP_001670767.1.89634 WP_001670767.1.89647 WP_001670767.1.89657 WP_001670767.1.89659 WP_001670767.1.89680 WP_001670767.1.89746 WP_001670767.1.89764 WP_001670767.1.89765 WP_001670767.1.89777 WP_001670767.1.89789 WP_001670767.1.89815 WP_001670767.1.89817 WP_001670767.1.89832 WP_001670767.1.89870 WP_001670767.1.89902 WP_001670767.1.89914 WP_001670767.1.89940 WP_001670767.1.8996 WP_001670767.1.89965 WP_001670767.1.9002 WP_001670767.1.9003 WP_001670767.1.90033 WP_001670767.1.90084 WP_001670767.1.90097 WP_001670767.1.90108 WP_001670767.1.90193 WP_001670767.1.90211 WP_001670767.1.90220 WP_001670767.1.90248 WP_001670767.1.90252 WP_001670767.1.90293 WP_001670767.1.90311 WP_001670767.1.90348 WP_001670767.1.90363 WP_001670767.1.90409 WP_001670767.1.90417 WP_001670767.1.90421 WP_001670767.1.90440 WP_001670767.1.90453 WP_001670767.1.90458 WP_001670767.1.90472 WP_001670767.1.90521 WP_001670767.1.90522 WP_001670767.1.90540 WP_001670767.1.90557 WP_001670767.1.90563 WP_001670767.1.90566 WP_001670767.1.90585 WP_001670767.1.90620 WP_001670767.1.9064 WP_001670767.1.90641 WP_001670767.1.90686 WP_001670767.1.90701 WP_001670767.1.90734 WP_001670767.1.90748 WP_001670767.1.90759 WP_001670767.1.90792 WP_001670767.1.90814 WP_001670767.1.90859 WP_001670767.1.90866 WP_001670767.1.90876 WP_001670767.1.90878 WP_001670767.1.9089 WP_001670767.1.9093 WP_001670767.1.90959 WP_001670767.1.90973 WP_001670767.1.90983 WP_001670767.1.90984 WP_001670767.1.90991 WP_001670767.1.91003 WP_001670767.1.91023 WP_001670767.1.91049 WP_001670767.1.91056 WP_001670767.1.91069 WP_001670767.1.91107 WP_001670767.1.91156 WP_001670767.1.91179 WP_001670767.1.91189 WP_001670767.1.91215 WP_001670767.1.91278 WP_001670767.1.91282 WP_001670767.1.9131 WP_001670767.1.91312 WP_001670767.1.91331 WP_001670767.1.91334 WP_001670767.1.9137 WP_001670767.1.91372 WP_001670767.1.91381 WP_001670767.1.91405 WP_001670767.1.91424 WP_001670767.1.91459 WP_001670767.1.91470 WP_001670767.1.91473 WP_001670767.1.91474 WP_001670767.1.91505 WP_001670767.1.91512 WP_001670767.1.91524 WP_001670767.1.91564 WP_001670767.1.91580 WP_001670767.1.91621 WP_001670767.1.91625 WP_001670767.1.91628 WP_001670767.1.91655 WP_001670767.1.9166 WP_001670767.1.91702 WP_001670767.1.91724 WP_001670767.1.91732 WP_001670767.1.91736 WP_001670767.1.91742 WP_001670767.1.91772 WP_001670767.1.91776 WP_001670767.1.91788 WP_001670767.1.91795 WP_001670767.1.91864 WP_001670767.1.91880 WP_001670767.1.91898 WP_001670767.1.91903 WP_001670767.1.91914 WP_001670767.1.91974 WP_001670767.1.91984 WP_001670767.1.92039 WP_001670767.1.92044 WP_001670767.1.92047 WP_001670767.1.92060 WP_001670767.1.92067 WP_001670767.1.92068 WP_001670767.1.92082 WP_001670767.1.92093 WP_001670767.1.92099 WP_001670767.1.92108 WP_001670767.1.92122 WP_001670767.1.92129 WP_001670767.1.92149 WP_001670767.1.92165 WP_001670767.1.92171 WP_001670767.1.92183 WP_001670767.1.92208 WP_001670767.1.92213 WP_001670767.1.9222 WP_001670767.1.92268 WP_001670767.1.92270 WP_001670767.1.92299 WP_001670767.1.92310 WP_001670767.1.92318 WP_001670767.1.92375 WP_001670767.1.92399 WP_001670767.1.92408 WP_001670767.1.92411 WP_001670767.1.92439 WP_001670767.1.92443 WP_001670767.1.92452 WP_001670767.1.92482 WP_001670767.1.92529 WP_001670767.1.92531 WP_001670767.1.92557 WP_001670767.1.92562 WP_001670767.1.92575 WP_001670767.1.92646 WP_001670767.1.92659 WP_001670767.1.92669 WP_001670767.1.92671 WP_001670767.1.92729 WP_001670767.1.92738 WP_001670767.1.92754 WP_001670767.1.92758 WP_001670767.1.92786 WP_001670767.1.92806 WP_001670767.1.92827 WP_001670767.1.92832 WP_001670767.1.92836 WP_001670767.1.92842 WP_001670767.1.92843 WP_001670767.1.92875 WP_001670767.1.92879 WP_001670767.1.92883 WP_001670767.1.92890 WP_001670767.1.92893 WP_001670767.1.92895 WP_001670767.1.92926 WP_001670767.1.92929 WP_001670767.1.92936 WP_001670767.1.92947 WP_001670767.1.92975 WP_001670767.1.92988 WP_001670767.1.93059 WP_001670767.1.93061 WP_001670767.1.93076 WP_001670767.1.93086 WP_001670767.1.93101 WP_001670767.1.93118 WP_001670767.1.93136 WP_001670767.1.93155 WP_001670767.1.93213 WP_001670767.1.93215 WP_001670767.1.93275 WP_001670767.1.93322 WP_001670767.1.93339 WP_001670767.1.93350 WP_001670767.1.93365 WP_001670767.1.93376 WP_001670767.1.93410 WP_001670767.1.93524 WP_001670767.1.93543 WP_001670767.1.93577 WP_001670767.1.93596 WP_001670767.1.93604 WP_001670767.1.93648 WP_001670767.1.93650 WP_001670767.1.93656 WP_001670767.1.93662 WP_001670767.1.93671 WP_001670767.1.93691 WP_001670767.1.937 WP_001670767.1.93705 WP_001670767.1.93741 WP_001670767.1.93761 WP_001670767.1.93767 WP_001670767.1.9380 WP_001670767.1.93803 WP_001670767.1.93804 WP_001670767.1.93809 WP_001670767.1.93837 WP_001670767.1.9389 WP_001670767.1.93937 WP_001670767.1.93956 WP_001670767.1.93986 WP_001670767.1.93994 WP_001670767.1.94039 WP_001670767.1.94056 WP_001670767.1.94064 WP_001670767.1.94070 WP_001670767.1.94071 WP_001670767.1.94072 WP_001670767.1.94162 WP_001670767.1.94167 WP_001670767.1.94168 WP_001670767.1.94181 WP_001670767.1.94198 WP_001670767.1.9432 WP_001670767.1.94352 WP_001670767.1.94354 WP_001670767.1.94379 WP_001670767.1.94380 WP_001670767.1.94383 WP_001670767.1.9440 WP_001670767.1.94412 WP_001670767.1.94458 WP_001670767.1.94473 WP_001670767.1.94557 WP_001670767.1.94562 WP_001670767.1.94565 WP_001670767.1.94584 WP_001670767.1.94598 WP_001670767.1.94622 WP_001670767.1.9463 WP_001670767.1.94649 WP_001670767.1.94655 WP_001670767.1.94669 WP_001670767.1.94670 WP_001670767.1.94674 WP_001670767.1.94717 WP_001670767.1.94722 WP_001670767.1.94785 WP_001670767.1.94796 WP_001670767.1.94798 WP_001670767.1.9481 WP_001670767.1.94817 WP_001670767.1.94835 WP_001670767.1.94849 WP_001670767.1.94862 WP_001670767.1.94947 WP_001670767.1.94959 WP_001670767.1.94967 WP_001670767.1.94971 WP_001670767.1.94982 WP_001670767.1.94983 WP_001670767.1.94986 WP_001670767.1.94987 WP_001670767.1.9503 WP_001670767.1.95051 WP_001670767.1.95085 WP_001670767.1.95094 WP_001670767.1.95121 WP_001670767.1.95133 WP_001670767.1.95152 WP_001670767.1.9516 WP_001670767.1.95171 WP_001670767.1.95235 WP_001670767.1.95248 WP_001670767.1.95249 WP_001670767.1.9527 WP_001670767.1.95277 WP_001670767.1.95282 WP_001670767.1.95298 WP_001670767.1.9530 WP_001670767.1.95320 WP_001670767.1.95388 WP_001670767.1.95404 WP_001670767.1.95434 WP_001670767.1.95447 WP_001670767.1.95456 WP_001670767.1.95465 WP_001670767.1.95546 WP_001670767.1.95558 WP_001670767.1.95579 WP_001670767.1.95607 WP_001670767.1.95623 WP_001670767.1.95630 WP_001670767.1.95656 WP_001670767.1.95670 WP_001670767.1.95691 WP_001670767.1.95701 WP_001670767.1.95703 WP_001670767.1.95729 WP_001670767.1.9574 WP_001670767.1.95744 WP_001670767.1.95757 WP_001670767.1.95803 WP_001670767.1.95805 WP_001670767.1.95826 WP_001670767.1.95840 WP_001670767.1.9586 WP_001670767.1.95866 WP_001670767.1.95901 WP_001670767.1.95911 WP_001670767.1.95939 WP_001670767.1.95963 WP_001670767.1.96004 WP_001670767.1.96042 WP_001670767.1.96045 WP_001670767.1.9609 WP_001670767.1.96107 WP_001670767.1.96139 WP_001670767.1.96162 WP_001670767.1.96172 WP_001670767.1.96190 WP_001670767.1.96203 WP_001670767.1.96206 WP_001670767.1.9624 WP_001670767.1.96260 WP_001670767.1.96317 WP_001670767.1.96335 WP_001670767.1.96340 WP_001670767.1.96343 WP_001670767.1.96348 WP_001670767.1.96349 WP_001670767.1.96380 WP_001670767.1.96404 WP_001670767.1.96429 WP_001670767.1.9644 WP_001670767.1.96469 WP_001670767.1.96490 WP_001670767.1.96497 WP_001670767.1.96500 WP_001670767.1.96521 WP_001670767.1.96533 WP_001670767.1.96537 WP_001670767.1.96555 WP_001670767.1.96563 WP_001670767.1.96584 WP_001670767.1.96588 WP_001670767.1.96590 WP_001670767.1.96600 WP_001670767.1.96640 WP_001670767.1.96642 WP_001670767.1.96662 WP_001670767.1.96721 WP_001670767.1.96731 WP_001670767.1.96732 WP_001670767.1.96735 WP_001670767.1.9674 WP_001670767.1.96758 WP_001670767.1.96771 WP_001670767.1.96798 WP_001670767.1.96810 WP_001670767.1.9686 WP_001670767.1.96876 WP_001670767.1.96890 WP_001670767.1.96902 WP_001670767.1.96917 WP_001670767.1.96993 WP_001670767.1.97005 WP_001670767.1.97015 WP_001670767.1.97043 WP_001670767.1.97047 WP_001670767.1.97089 WP_001670767.1.97103 WP_001670767.1.97109 WP_001670767.1.97143 WP_001670767.1.97145 WP_001670767.1.97185 WP_001670767.1.97190 WP_001670767.1.97224 WP_001670767.1.97260 WP_001670767.1.97297 WP_001670767.1.97318 WP_001670767.1.97322 WP_001670767.1.97328 WP_001670767.1.97368 WP_001670767.1.97369 WP_001670767.1.97386 WP_001670767.1.97413 WP_001670767.1.97477 WP_001670767.1.97480 WP_001670767.1.97487 WP_001670767.1.97496 WP_001670767.1.97534 WP_001670767.1.97547 WP_001670767.1.97594 WP_001670767.1.97597 WP_001670767.1.97613 WP_001670767.1.97620 WP_001670767.1.97626 WP_001670767.1.97628 WP_001670767.1.97631 WP_001670767.1.97640 WP_001670767.1.97648 WP_001670767.1.97656 WP_001670767.1.97691 WP_001670767.1.97693 WP_001670767.1.97704 WP_001670767.1.97725 WP_001670767.1.97726 WP_001670767.1.97727 WP_001670767.1.97732 WP_001670767.1.97736 WP_001670767.1.9774 WP_001670767.1.9775 WP_001670767.1.97768 WP_001670767.1.97800 WP_001670767.1.97846 WP_001670767.1.97873 WP_001670767.1.97907 WP_001670767.1.9793 WP_001670767.1.97981 WP_001670767.1.97983 WP_001670767.1.9799 WP_001670767.1.97991 WP_001670767.1.98006 WP_001670767.1.98019 WP_001670767.1.98022 WP_001670767.1.9805 WP_001670767.1.98107 WP_001670767.1.9811 WP_001670767.1.98110 WP_001670767.1.98119 WP_001670767.1.98124 WP_001670767.1.98146 WP_001670767.1.98170 WP_001670767.1.98201 WP_001670767.1.98219 WP_001670767.1.98236 WP_001670767.1.98250 WP_001670767.1.9826 WP_001670767.1.98314 WP_001670767.1.98338 WP_001670767.1.98392 WP_001670767.1.98402 WP_001670767.1.98403 WP_001670767.1.9841 WP_001670767.1.98438 WP_001670767.1.98440 WP_001670767.1.98446 WP_001670767.1.98472 WP_001670767.1.98495 WP_001670767.1.98513 WP_001670767.1.98531 WP_001670767.1.98551 WP_001670767.1.98570 WP_001670767.1.98577 WP_001670767.1.98608 WP_001670767.1.98627 WP_001670767.1.9863 WP_001670767.1.98634 WP_001670767.1.98676 WP_001670767.1.98677 WP_001670767.1.98726 WP_001670767.1.98751 WP_001670767.1.98760 WP_001670767.1.98763 WP_001670767.1.98779 WP_001670767.1.98843 WP_001670767.1.9887 WP_001670767.1.98899 WP_001670767.1.98931 WP_001670767.1.98947 WP_001670767.1.9898 WP_001670767.1.9899 WP_001670767.1.99040 WP_001670767.1.99057 WP_001670767.1.99072 WP_001670767.1.99073 WP_001670767.1.99083 WP_001670767.1.99097 WP_001670767.1.99098 WP_001670767.1.99107 WP_001670767.1.99164 WP_001670767.1.99184 WP_001670767.1.99197 WP_001670767.1.99215 WP_001670767.1.99219 WP_001670767.1.99255 WP_001670767.1.99267 WP_001670767.1.99276 WP_001670767.1.99278 WP_001670767.1.99327 WP_001670767.1.99339 WP_001670767.1.99370 WP_001670767.1.99426 WP_001670767.1.99456 WP_001670767.1.99469 WP_001670767.1.99490 WP_001670767.1.99493 WP_001670767.1.99531 WP_001670767.1.99561 WP_001670767.1.99577 WP_001670767.1.99613 WP_001670767.1.99626 WP_001670767.1.99630 WP_001670767.1.99637 WP_001670767.1.99646 WP_001670767.1.99657 WP_001670767.1.99660 WP_001670767.1.99712 WP_001670767.1.99725 WP_001670767.1.99747 WP_001670767.1.99783 WP_001670767.1.99813 WP_001670767.1.99858 WP_001670767.1.99889 WP_001670767.1.99924 WP_001670767.1.99958 WP_001670767.1.99961 gi|559997291|ref|YP_008251921.2| gi|525814559|ref|YP_008244577.1| gi|56415214|ref|YP_152289.1| gi|197364144|ref|YP_002143781.1| gi|16766580|ref|NP_462195.1| gi|482905850|ref|YP_007904410.1| gi|378990593|ref|YP_005253757.1| gi|550902639|ref|YP_008671731.1| gi|452122898|ref|YP_007473146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]