SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 295405.BF0354 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295405.BF0354
Domain Number 1 Region: 368-672
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.4e-48
Family alpha-L-arabinanase-like 0.0021
Further Details:      
 
Domain Number 2 Region: 51-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.98e-29
Family Clostridium neurotoxins, the second last domain 0.086
Further Details:      
 
Domain Number 3 Region: 864-993
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-22
Family Family 6 carbohydrate binding module, CBM6 0.0013
Further Details:      
 
Domain Number 4 Region: 694-827
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000376
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 295405.BF0354
Sequence length 997
Comment (Bacteroides fragilis YCH46)
Sequence
MFINSLRKSPFSCSPGLILLGAFTLLSVPVYGQQIQQAERQVQQVPFLQFNFDEQGGETA
RNSGSGGSKYDARINGGTVEWGPGLQQGAARLSNKGHFKLPDGVLAHVKDFTLSVWVYLN
EQSDNQTVCTFACGTDRYLILTTQRGNEENGVSLVMTKTQESGNHTDKEERIAYTRQKGK
LSANAWHHLAFTLKGSVGTLYVDGVKVEIKTDFTVNPSLLGNTTDNYIGRPTWPDPYLNG
GIDDFRLYDYALTDRQVYELASVADGRLVQEDRDGLSLGDLSAVTTDLVLPSSGKSGTTI
SWSSAQGQYISDSGKLYRPDAGTGNKKATLTATVRKGDVALTKDFVLTVKDIGTEPEDVN
VFSMQTGNPTVPAYLADASFYYDDRTKTFYAFGTNDGAGGENVYPAQMWYSKDCKEWKNK
VIAFPKSWTDYAGTLCVWAPSIEYNPDTKKYYLMYSIASNTFVGMADDLLGPWEDANGAA
PGKMLFKGYDGQFFMDDDRTMYIVTDSWHFKIMKLKFDEAGKIYIDNSDPVFAKSDSNPF
IGTYHYTQIEEIKNAFEASFIFKRNNLYYLMWSFNGSENYNVRYAVADKITGPYREINRS
MTVPILQRDDANRILGPGHHSMFCYGGRTFIAYHRQHYPFVDSKRQTCIDEVFFNEDGSI
RPITPTHKGVTVAPDVPGDHRTNLALGKQTLTSSARVYDDSEFAPRYRTHGISFCYAGNF
AVDENYGTHWDPGVGAHKPWLIVDLGSECKVDEIETIFEFTSRTYKYKLEYLSQKEAGSL
DAASGSHLWKVFADRSTDGVGQSPVTDTKPGNSPVKARFIRLTILEGVDIPLRADGLDKK
NAENALSIFELKVFGEDRSDALNRIFEAESFHNLYGIALEKNAAENGFIMGQIDNNDYLL
YRNVDLGKGTSTFTAKVASGTEGGKIEVYLGSLKGKPIGVLEVGNTGGDQSWEIKSTSLE
RIARGRQEKLYLLFKGKTGTENLLKLDWFQFTKDRMK
Download sequence
Identical sequences Q64ZH3
YP_097637.1.45732 295405.BF0354 gi|53711645|ref|YP_097637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]