SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 295405.BF2230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295405.BF2230
Domain Number 1 Region: 48-171
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.97e-35
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 231-336
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.77e-33
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 163-231
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.48e-21
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 295405.BF2230
Sequence length 386
Comment (Bacteroides fragilis YCH46)
Sequence
MKTTRYIYTALILAALSQGNAVAQNKGGFFSKVRDTFSTEIKIGNYTFKDGSVYTGEMKG
RKPNGKGKTVFKNGDVYEGEYVKGKREGFGVYTFPDGERYEGQWYQDQQHGNGIYYFMNN
NRYDGMWFQDYQHGPGTMYYHNGDIYVGDWVNDKREGKGTYTWRDGSKYVGDWKNDKKDG
KGVLVWNDGCKYDGDWKNDVREGKGTFEYTNGEKYVGDWKDDLQHGKGIFFLGGDRYEGS
YLQGERTGPGIYYHANGDKYVGNFKDGMQDGEGTFTWANGAVYEGEWKDNKRNGHGIYKW
SNGDVYEGEWKNNQPNGKGTLTLTNGTKYKGGFVNGMQEGNGVEEDKNGNRYEGFFKQGK
KNGPFVETDKNGKVIRKGTYKFGRLE
Download sequence
Identical sequences A0A015S081 A0A016BVW6 A0A016BWX0 A0A016DLK2 A0A016JKW3 A0A0E2APF9 A0A0E2AQ48 A0A139TEZ5 A0A149NLV0 I9VFW2 K1FSI3 Q64U52
gi|53713519|ref|YP_099511.1| WP_005787585.1.10040 WP_005787585.1.100686 WP_005787585.1.101046 WP_005787585.1.11335 WP_005787585.1.33107 WP_005787585.1.37988 WP_005787585.1.44936 WP_005787585.1.46679 WP_005787585.1.50677 WP_005787585.1.53995 WP_005787585.1.58084 WP_005787585.1.60699 WP_005787585.1.6251 WP_005787585.1.63108 WP_005787585.1.63925 WP_005787585.1.65921 WP_005787585.1.78347 WP_005787585.1.85293 WP_005787585.1.89499 WP_005787585.1.89819 WP_005787585.1.9461 WP_005787585.1.95750 WP_005787585.1.97349 YP_099511.1.45732 295405.BF2230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]