SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 295405.BF3342 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295405.BF3342
Domain Number 1 Region: 129-444
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.45e-96
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000249
Further Details:      
 
Domain Number 2 Region: 443-622
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-30
Family Glycosyl hydrolases family 32 C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 295405.BF3342
Sequence length 622
Comment (Bacteroides fragilis YCH46)
Sequence
MKTTFMNVSRGVIGALAFSLGISSCQSSQSKMTFEQEGDSLTVIHITNPTQYLLLPVEEK
TPEAQVCIASDSVPVDMDVRLSREKVDYFVPFALPKGEKEVAVRIRHLPKEALCWKELKL
SDTFDTTNTDQYRPLYHHTPLYGWMNDANGLVYKDGEYHLFYQYNPYGSMWGNMHWGHSV
SKDLVHWEHLEPALARDTLGHIFSGSSVVDDANTAGYGAGAIVAFYTSASDKNGQIQCMA
YSTDNGRTFTKYEKNPVLTPFDGLKDFRDPKVFWYAPDQKWVMVVSADKEMRFYSSENLK
EWTYMSGWGEGYGVQPSQFECPDMVELPVDGNPDHKKWALIVNVNPGCYFGGSATQYFIG
DFDGEKFVCDNKPETVKWLDWGKDHYATVCFSNTGDRTIAVPWMSNWQYANIVPTRQFRS
ANALPRELSLYTQDGDIYMAAAPVEETKSLRKESQEIPAFEVGDAYHVDSLLSDNKGAYE
IELELAAGSAEIMGLKLFNEKGENVDIYISLPEKKLVMDRTKSGIVDFGKDSAPHAIEAH
DRRKQNSINYVDDFALGTWAPVQKAGNYKLDIFVDKCSVEIFLNGGKIAMTNLIFPTTPY
NQMSFYSRGGAFKVDRCKIYRL
Download sequence
Identical sequences Q64QZ5
gi|53714628|ref|YP_100620.1| WP_011203243.1.76253 YP_100620.1.45732 295405.BF3342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]