SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 295405.BF3902 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295405.BF3902
Domain Number 1 Region: 4-214
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 9.94e-69
Family D-ribulose-5-phosphate 3-epimerase 0.00000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 295405.BF3902
Sequence length 216
Comment (Bacteroides fragilis YCH46)
Sequence
MKPIISPSILSADFAYLAKDIEMINRSEADWVHIDIMDGVFVPNISFGFPVLKYVAKLTS
KPLDVHLMIVNPEKFIPEVKALGAHIMNVHYEACPHLHRVVQQIREAGMQPAVTINPATP
IALLQDIIRDVYMVLVMSVNPGFGGQKFIEHSVEKVKELRELIERTGSKALIEVDGGVNL
ETGARLIAAGADALVAGNAIFAAENPEGMIHAMKGL
Download sequence
Identical sequences A0A015UG94 A0A015X0F4 A0A015Y9S6 A0A016AF65 A0A016CKY8 A0A016E3I0 A0A016HV74 A0A017N9N0 A0A0E2RJ48 A0A2J6AJ13 E1WMT4 F7LS80 I9JYZ1 K1FWR4 Q64PD7 R6ZGX0
295405.BF3902 WP_005802152.1.10040 WP_005802152.1.101046 WP_005802152.1.15557 WP_005802152.1.2011 WP_005802152.1.21107 WP_005802152.1.26934 WP_005802152.1.30608 WP_005802152.1.31541 WP_005802152.1.32651 WP_005802152.1.33107 WP_005802152.1.34692 WP_005802152.1.35533 WP_005802152.1.35818 WP_005802152.1.40326 WP_005802152.1.4066 WP_005802152.1.43770 WP_005802152.1.44936 WP_005802152.1.48703 WP_005802152.1.49420 WP_005802152.1.49748 WP_005802152.1.50677 WP_005802152.1.5142 WP_005802152.1.51489 WP_005802152.1.53995 WP_005802152.1.57121 WP_005802152.1.63108 WP_005802152.1.63925 WP_005802152.1.65409 WP_005802152.1.65726 WP_005802152.1.65921 WP_005802152.1.66858 WP_005802152.1.66941 WP_005802152.1.69826 WP_005802152.1.73957 WP_005802152.1.75668 WP_005802152.1.76253 WP_005802152.1.89499 WP_005802152.1.91849 WP_005802152.1.93484 WP_005802152.1.94953 WP_005802152.1.97349 YP_101178.1.45732 gi|375359952|ref|YP_005112724.1| gi|53715186|ref|YP_101178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]