SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 295405.BF4326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295405.BF4326
Domain Number 1 Region: 299-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.18e-48
Family Ribonuclease PH domain 1-like 0.0000786
Further Details:      
 
Domain Number 2 Region: 13-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.02e-43
Family Ribonuclease PH domain 1-like 0.0001
Further Details:      
 
Domain Number 3 Region: 146-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.94e-27
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 452-553
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.72e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 232-330
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.26e-23
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0034
Further Details:      
 
Domain Number 6 Region: 616-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.31e-19
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 
Domain Number 7 Region: 556-636
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000352
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 295405.BF4326
Sequence length 708
Comment (Bacteroides fragilis YCH46)
Sequence
MINPIVKTIELGDGRTITLETGKLAKQADGSVMLRMGNTMLLATVCAAKDAVPGTDFMPL
QVEYKEKFAAFGRFPGGFTKREGRASDYEILTCRLVDRALRPLFPDNYHAEVYVNIILFS
ADGVDMPDALAGLAASAALAVSDIPFNGPISEVRVARIDGKFVINPTFDQLEQADMDIMV
AATYENIMMVEGEMSEVSEAELLEAMKVAHEAIKVHCKAQMELTEMVGKTVKREYCHEEN
DEELRKAVHDACYDKSYAIAASGNRNKHERQDAFDAIRDEFKAQFSEEELEEKGALIDRY
YHDVEKEAMRRCILDEGKRLDGRKTTEIRPIWCEVGYLPGPHGSAIFTRGETQSLTSVTL
GTKLDEKIIDDVLAHGKERFLLHYNFPPFSTGEAKAQRGVGRREIGHGNLAHRALKRMIP
EDYPYVVRVVSDILESNGSSSMATVCAGTLALMDAGVKIKKPVSGIAMGLIKNAGEEKYA
VLSDILGDEDHLGDMDFKVTGTKDGITATQMDIKVDGLSYEILERALNQAKEGRMHILGK
IEETISEPRTELKDHAPRIETMTIPKEFIGAVIGPGGKIIQGMQEETGATITIEEIDNVG
RIEISGTNKKSIDDAIRLIKGIVAVPEVGEVYKGKVRSIMPYGAFVEFLPGKDGLLHISE
IDWKRLETVEEAGIKEGDEIEVKLIDIDPKTGKFKLSRKVLLPRPEKK
Download sequence
Identical sequences A0A015SEW0 A0A015V8K5 A0A015VRI2 A0A015WQ79 A0A015ZLP9 A0A016A5T7 A0A016CIM7 A0A016FGF8 A0A016H2X8 A0A0E2AI90 A0A0E2AJC2 A0A0E2STD9 A0A0E2TK35 A0A0K6C038 D1JVL9 E1WQ12 F7LV57 I9VCQ9 K1G3V5 Q5L7Z7 Q64N73
WP_005791373.1.10040 WP_005791373.1.10083 WP_005791373.1.101046 WP_005791373.1.10405 WP_005791373.1.11335 WP_005791373.1.15557 WP_005791373.1.18542 WP_005791373.1.21713 WP_005791373.1.21908 WP_005791373.1.22050 WP_005791373.1.23698 WP_005791373.1.26260 WP_005791373.1.26832 WP_005791373.1.30158 WP_005791373.1.31541 WP_005791373.1.32651 WP_005791373.1.33107 WP_005791373.1.34692 WP_005791373.1.35533 WP_005791373.1.35818 WP_005791373.1.36984 WP_005791373.1.37052 WP_005791373.1.37988 WP_005791373.1.38746 WP_005791373.1.39779 WP_005791373.1.40326 WP_005791373.1.40404 WP_005791373.1.42362 WP_005791373.1.43857 WP_005791373.1.44936 WP_005791373.1.456 WP_005791373.1.46679 WP_005791373.1.48703 WP_005791373.1.50677 WP_005791373.1.51373 WP_005791373.1.5142 WP_005791373.1.51489 WP_005791373.1.51763 WP_005791373.1.52936 WP_005791373.1.53885 WP_005791373.1.53910 WP_005791373.1.53995 WP_005791373.1.54019 WP_005791373.1.55270 WP_005791373.1.56204 WP_005791373.1.57121 WP_005791373.1.58084 WP_005791373.1.60699 WP_005791373.1.60854 WP_005791373.1.6251 WP_005791373.1.63108 WP_005791373.1.63590 WP_005791373.1.63925 WP_005791373.1.65921 WP_005791373.1.66858 WP_005791373.1.66941 WP_005791373.1.69826 WP_005791373.1.73957 WP_005791373.1.75176 WP_005791373.1.7580 WP_005791373.1.76253 WP_005791373.1.77492 WP_005791373.1.78347 WP_005791373.1.81678 WP_005791373.1.85293 WP_005791373.1.87523 WP_005791373.1.88754 WP_005791373.1.89424 WP_005791373.1.89499 WP_005791373.1.89819 WP_005791373.1.91045 WP_005791373.1.93759 WP_005791373.1.9461 WP_005791373.1.94953 WP_005791373.1.95091 WP_005791373.1.95750 WP_005791373.1.97349 WP_005791373.1.97365 WP_005791373.1.97964 WP_005791373.1.98903 WP_005791373.1.9932 YP_101598.1.45732 gi|375360383|ref|YP_005113155.1| 272559.BF4129 295405.BF4326 gi|60683550|ref|YP_213694.1| gi|53715606|ref|YP_101598.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]