SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 295405.BF4338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  295405.BF4338
Domain Number 1 Region: 26-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-58
Family Glycosyl hydrolases family 16 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 295405.BF4338
Sequence length 264
Comment (Bacteroides fragilis YCH46)
Sequence
MKTKTFLALFCLLCISSGFSSCQRHSSDQWKLVWEDNFDQKTGFDPQVWSKIPRGKSDWN
NYMTDFDSCFDMRDGNMVLRGIINYSQPNDTAPYLTGGIYTKGKKAFSNGRLEIRAKLNG
ARGEWPAIWMLPIDAPWPMGGEIDIMERLNHDTIAYQTIHTNYTYNLGIKDNPLSHSVGA
INPDDYNVYSVEMYPDSIAFYINDTHTFTYPRIETDKEGQFPFDQPFYLLIDMQLGGSWV
GAVDPKELPVEMYVDWVRFYQKEK
Download sequence
Identical sequences A0A016DSC8 A0A016HTR6 A0A017N142 A0A0E2A7X8 A0A0E2RL10 A0A0E2TJI9 A0A2J6ARA7 D1JVK7 E1WQ22 I9B0N8 Q64N61
gi|375360393|ref|YP_005113165.1| gi|53715618|ref|YP_101610.1| WP_005791347.1.10083 WP_005791347.1.21107 WP_005791347.1.21713 WP_005791347.1.22050 WP_005791347.1.26832 WP_005791347.1.26934 WP_005791347.1.31541 WP_005791347.1.32651 WP_005791347.1.34692 WP_005791347.1.35533 WP_005791347.1.43857 WP_005791347.1.44936 WP_005791347.1.49748 WP_005791347.1.50935 WP_005791347.1.51373 WP_005791347.1.5142 WP_005791347.1.51489 WP_005791347.1.51763 WP_005791347.1.52936 WP_005791347.1.54019 WP_005791347.1.55270 WP_005791347.1.63108 WP_005791347.1.66858 WP_005791347.1.66941 WP_005791347.1.73957 WP_005791347.1.76253 WP_005791347.1.85293 WP_005791347.1.87523 WP_005791347.1.88754 WP_005791347.1.89499 WP_005791347.1.93759 WP_005791347.1.9461 WP_005791347.1.94953 WP_005791347.1.95195 WP_005791347.1.97964 WP_005791347.1.98903 YP_101610.1.45732 295405.BF4338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]