SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 296591.Bpro_2694 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  296591.Bpro_2694
Domain Number 1 Region: 152-298
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.54e-40
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000479
Further Details:      
 
Domain Number 2 Region: 55-147
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 5.23e-23
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00065
Further Details:      
 
Domain Number 3 Region: 1-55
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000469
Family TS-N domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 296591.Bpro_2694
Sequence length 304
Comment (Polaromonas JS666)
Sequence
MAITASMVAELRAKTDAPMMECKKALTEADGNFEKAEEILRVKLGNKAGKAASRVTAEGV
IAYHSEGGIGALVEINCETDFVTKNDSFLAFTKAVAEGIVKNNPADVDAIGAMALSLDGF
GPTVEDVRKGLIGKIGENMSVRRFKRFAGSKLASYLHGTRIGVVVEFDGDETAAKDVAMH
VAAMKPVSLSSADVPADLVAKERSVAAAKAAEDAAKAQAEGKPVQSAEIVAKRIDGGVQK
YLKEVSLYNQSFVKNDKQTVEQMLKERATTVKSFTLYVVGEGIEKKADDFAAEVAAQIAA
AKAA
Download sequence
Identical sequences Q12A32
296591.Bpro_2694 gi|91788556|ref|YP_549508.1| WP_011483608.1.11221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]