SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 297245.lpl2001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  297245.lpl2001
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily Chaperone J-domain 6.15e-37
Family Chaperone J-domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 260-345
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 9.68e-23
Family HSP40/DnaJ peptide-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 135-212
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.22e-22
Family DnaJ/Hsp40 cysteine-rich domain 0.00006
Further Details:      
 
Domain Number 4 Region: 116-139,187-257
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.7e-17
Family HSP40/DnaJ peptide-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 297245.lpl2001
Sequence length 379
Comment (Legionella pneumophila Lens)
Sequence
MEQRDYYELLEVSRNASDAEIKKAYRRLAMKYHPDRNPGDTSAEEKFKEIQKAYNILSDK
QKRAAYDQFGHAGVDPSMGGGPGGFGGFGGFGDVFEDIFENIFSGGRGQGRQSRGQRGAD
LQFNVQLTLEEAAIGKEVEITVPRHGTCTVCEGSGAKKGTSPKTCETCQGMGQVRIQQGF
FSIQQTCPTCHGEGKIISDPCASCHGQGRVRESKKINVKIPAGVDNGDRVRLSGEGEAGV
HGGGSGDLYVQISLKKHAIFERHENDLHCEVPISFATAALGGSIEVPTLEGRVTLKIPAE
TQTGKVFRLRSKGMKSVRGYGQGDLLCKVVVETPVNLSREQKELLNKLQDSLENAKGTHS
PKTSSWFAGVKKFFEDMKF
Download sequence
Identical sequences Q5WV16
WP_011215984.1.25566 WP_011215984.1.40024 WP_011215984.1.47557 WP_011215984.1.62869 WP_011215984.1.85655 WP_011215984.1.85818 WP_011215984.1.90773 WP_011215984.1.93162 gi|54294922|ref|YP_127337.1| 297245.lpl2001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]