SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 297245.lpl2685 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  297245.lpl2685
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-50
Family Ribonuclease PH domain 1-like 0.0000263
Further Details:      
 
Domain Number 2 Region: 289-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-49
Family Ribonuclease PH domain 1-like 0.0000131
Further Details:      
 
Domain Number 3 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-30
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.36e-27
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 5 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.17e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 619-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.81e-17
Family Cold shock DNA-binding domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 297245.lpl2685
Sequence length 729
Comment (Legionella pneumophila Lens)
Sequence
MAKITKEIVFGNHKLILETGEVARQADGAVMASMNGTQVLVTVVWKKDGGESNDFFPLTV
NYQEKFYAIGKIPGGFNKREGRPSDNETLISRLIDRPIRPLFPDNFFNEVQIIATVLSLN
PEVSPDIIAMIGASAALSISGVPFNGPIGAARVGYKDGVYLLNPSRKEQEESKLDLVIAG
TKDAILMVESEAQELSEDIMRGAMLYGHEMMKNVIKSIEELARDVGKSKPEWKAPEIDTV
LKARINDVARNEVEAAYLIKDKQQRYQRLGELREQTISALLAENDELNADVIANMFGELE
RSIVRNRILDGEPRIDGRDHRTVRPISVRTKFLERTHGSCLFTRGETQAIVVATLGNERD
AQILDGISGESRDRFMLHYNFPPYSVGETGQVGSPKRREIGHGRLAKRALMAVLPDANEF
PYVLRIVSEITESNGSSSMATVCGTSLALMDAGVPLKAPVAGVAMGLIKEGDRYAVLTDI
LGDEDHLGDMDFKVAGTEKGITALQMDIKISGITNEIMERALEQALEGRTHILGVMNNAL
AEHRTELSQHAPRITTMKVAEDKIRTIIGKGGATIKGLIESTGVSIDIDDSGVIQLFSPD
KIALEEAQKQIKALIAEIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICAARTQK
VEEVLQEGQEIEVFVAGIDKQGRVKLEWKDKPQAEAKEVEDAPVSATFLTMEEQSEEINS
GNKISEEEE
Download sequence
Identical sequences Q5WT40
297245.lpl2685 WP_011216618.1.25566 WP_011216618.1.40024 WP_011216618.1.47557 WP_011216618.1.62869 WP_011216618.1.85655 WP_011216618.1.85818 WP_011216618.1.93162 gi|54295598|ref|YP_128013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]