SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 297246.lpp0664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  297246.lpp0664
Domain Number - Region: 27-75
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00419
Family SPRY domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 297246.lpp0664
Sequence length 114
Comment (Legionella pneumophila Paris)
Sequence
MRKHKNKMVRIFLLALGLFSSTTINAWYGSGITIGVARANVHYYGDDIRVYDPWGYGYYD
RNYYYNGVRNIIVPSVIVPNVVINVPVQRYYVPSCEEMEVCDPYGQCWLEQFCR
Download sequence
Identical sequences A0A1S0VC07
gi|54296633|ref|YP_123002.1| gi|397666288|ref|YP_006507825.1| 297246.lpp0664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]