SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 297246.lpp2816 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  297246.lpp2816
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.4e-50
Family Ribonuclease PH domain 1-like 0.0000259
Further Details:      
 
Domain Number 2 Region: 289-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-49
Family Ribonuclease PH domain 1-like 0.0000125
Further Details:      
 
Domain Number 3 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-30
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.56e-28
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 5 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.62e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 619-699
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.56e-17
Family Cold shock DNA-binding domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 297246.lpp2816
Sequence length 729
Comment (Legionella pneumophila Paris)
Sequence
MAKITKEIVFGNHKLILETGEVARQADGAVMASMNGTQVLVTVVWKKDSGESNDFFPLTV
NYQEKFYAIGKIPGGFNKREGRPSDNETLISRLIDRPIRPLFPDNFFNEVQIIATVLSLN
PEVSPDIIAMIGASAALSISGVPFNGPIGAARVGYKDGVYLLNPSRKEQEESKLDLVIAG
TKDAILMVESEAQELSEDIMRGAMLYGHEMMKSVIKSIEELAREVGKSKPEWKAPEIDTV
LKARINDVARNEVEAAYLIKDKQQRYQRLDELREQTISALLAENDELNADVIANMFGELE
RSIVRNRILDGEPRIDGRDHRTVRPISIRTKFLERTHGSCLFTRGETQAIVVATLGNERD
AQILDGISGETRDRFMLHYNFPPYSVGETGQVGSPKRREIGHGRLAKRALMAVLPDTNEF
PYVLRIVSEITESNGSSSMATVCGTSLALMDAGVPLKAPVAGVAMGLIKEGDRYAVLTDI
LGDEDHLGDMDFKVAGTEKGITALQMDIKISGITNEIMERALEQALEGRTHILGVMNNAL
AEHRTELSQHAPRITTMKVAEDKIRTIIGKGGATIKGLIESTGVSIDIDDSGVIQLFSPD
KMALEEAQKQIKALIAEIEVGQTYQGKVSKIVDFGAFINLLPGKDGLLHISQICAERTQK
VEEVLQEGQEIEVFVAGIDKQGRVKLEWKDKPQAEAKEVEGASVSATFLTMEEQSEEINS
GNKISEEEE
Download sequence
Identical sequences A0A1S0VIQ8 Q5X1C7
297246.lpp2816 gi|54298752|ref|YP_125121.1| WP_015961799.1.100609 WP_015961799.1.101326 WP_015961799.1.1173 WP_015961799.1.15769 WP_015961799.1.19781 WP_015961799.1.21849 WP_015961799.1.28040 WP_015961799.1.30351 WP_015961799.1.3122 WP_015961799.1.3258 WP_015961799.1.35807 WP_015961799.1.36016 WP_015961799.1.37161 WP_015961799.1.39582 WP_015961799.1.41396 WP_015961799.1.41414 WP_015961799.1.43838 WP_015961799.1.44947 WP_015961799.1.45039 WP_015961799.1.46375 WP_015961799.1.46948 WP_015961799.1.48987 WP_015961799.1.50379 WP_015961799.1.53443 WP_015961799.1.54450 WP_015961799.1.547 WP_015961799.1.5553 WP_015961799.1.58425 WP_015961799.1.5861 WP_015961799.1.58655 WP_015961799.1.59183 WP_015961799.1.61482 WP_015961799.1.63249 WP_015961799.1.63357 WP_015961799.1.64714 WP_015961799.1.65356 WP_015961799.1.65604 WP_015961799.1.67348 WP_015961799.1.69880 WP_015961799.1.72557 WP_015961799.1.728 WP_015961799.1.73276 WP_015961799.1.73409 WP_015961799.1.74197 WP_015961799.1.75016 WP_015961799.1.75926 WP_015961799.1.79423 WP_015961799.1.79768 WP_015961799.1.80208 WP_015961799.1.81040 WP_015961799.1.81849 WP_015961799.1.82883 WP_015961799.1.83690 WP_015961799.1.84032 WP_015961799.1.89129 WP_015961799.1.91040 WP_015961799.1.94262 WP_015961799.1.95686 WP_015961799.1.96370 WP_015961799.1.97870 WP_015961799.1.97946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]