SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00001512001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00001512001
Domain Number 1 Region: 194-469
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-65
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 11-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.98e-42
Family Legume lectins 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00001512001
Sequence length 498
Comment (Vitis vinifera)
Sequence
DNVTNTTVISFVAVEFDTFSNKAKRDPVSDHVGIDINSTISVKTVNWSSNIGEGKLNHVS
IRYTSSSQNLSVVLITEFMDDKTTSQSLSYKVDLREYLPEFVTIGFSGATGKAVQINNIY
SWNFSSTLQPPNPVEPGDGKKTGFVVGLSVGAVVVVCGLGLVWHHLRKKRNSGGEENGTD
SDLVMDEDFEKGTGPRKFSFDELALATSNFAEEEKLGEGGFGGVYRGFLRELNSYVAVKR
VSRGSKQGMKEYASEVKIISRLRHRNLVQLMGWYKIALGLASSLLYLHEEWEQCVVHRDI
KSSNVMLDSDFNAKLGDFGLARLVDHGKGSQTTVLAGTMGYMAPECLMTGKASKETDVYS
FGIVALEICCGRRPQIRLVEWVWDLYGVGKLVDAADPRLSDDFDEEQMERLMIVGLWCAH
PDCNLRPSIRQAINVLNSEASLPLLPLKMPVPMYYSPPVLQTISCGPTISESIHTSSSKL
FESPSSTSTPAASLLHTR
Download sequence
Identical sequences 29760.GSVIVG00001512001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]