SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00003824001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00003824001
Domain Number 1 Region: 419-591
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.14e-44
Family Ribonuclease PH domain 1-like 0.0000346
Further Details:      
 
Domain Number 2 Region: 79-217
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.63e-40
Family Ribonuclease PH domain 1-like 0.0000479
Further Details:      
 
Domain Number 3 Region: 218-304
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.62e-25
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 573-676
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.37e-23
Family Ribonuclease PH domain 2-like 0.00023
Further Details:      
 
Domain Number 5 Region: 747-826
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-16
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 
Domain Number 6 Region: 685-770
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00003824001
Domain Number - Region: 312-365
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00127
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00003824001
Sequence length 946
Comment (Vitis vinifera)
Sequence
MLANPSIHAPLLHTNRWRLPLSCNLHRSLRPKKAPRSSSSLLFSSKSCSFGVRALAESQA
SEINPSSVEAPPGVAQPFSVKIPVGDRHILVETGHIGRQASGSVTVTDGETIVYTSVCLA
DVPSEPSDFFPLSVNYQERFSAAGRTSGGFFKREGRTKDHEVLICRLIDRPLRPTMLKGF
YHETQILSWVLSYDGLHSPDSLAVTAAGIAVALSELPISKAVAGVRVGMVGNKFIINPTT
KEMEDSELDLLVAGTDSAILMIEGYCNFLPEEKLLQAVEVGQDAVRAICNEVEALAKKYG
KPKMLDAIKLPPPELYRHVEEIAGQQLGKVLQIRNKIPRRKALISLEEEVLTILTEEGYV
SKDETLGTAETIQDLFEDEDEDEEVVVDGEVDEGDVHIKPIPRKSSPLFFSEVDVKLVFK
EVTSKFLRRRIVEGGKRSDGRTPDGIRLINSQCGLLPRAHGSALFTRGETQSLAVVTLGD
RQMAQRIDNLVDVDELKRFYLQYSFPPSCVGEVGRMGAPSRREIGHGMLAERALEPILPS
EDDFPYTIRVESTITESNGSSSMASVCGGCLALQDAGVPVKYSIAGIAMGMVLNTEEFGG
DGTPLILSDITGSEDASGDMDFKVAGTEDGITAFQMDIKVGGITLPIMKQALLQAKDGRK
QILAEMSKCSPLPAKRLSKYAPLIHIMKVKPEKINIIIGPGGKKVKSIIEETGVEAIDTQ
DDGIVKITAKDLTSLEKSKTIISSLTMVPTVGDIYRNCEIKSIAPYGVFVEIASGREGLC
HISELSPSWLAKTEDAFKVGDRLDVKLIEINDKGQLRLSRKALLPNANPEKPSLKQRTSS
KENAASQKAPDKGTTKKAVNMPKDGLGEVNVELSNDTSSNPKPVSSHTTNSAEGDALPQK
IIKRLVSSGRDEPDTNKERPKKSISKAVTSVSNKDESSLVNGEAKI
Download sequence
Identical sequences XP_002270169.1.54126 29760.GSVIVG00003824001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]