SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00004033001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00004033001
Domain Number 1 Region: 30-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.57e-51
Family Legume lectins 0.0000124
Further Details:      
 
Domain Number 2 Region: 231-395
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.56e-30
Family Protein kinases, catalytic subunit 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00004033001
Sequence length 412
Comment (Vitis vinifera)
Sequence
MATSFCDLPTSITTNILSSLLCFIFLPCVYSVSFQISRFGRDGNILYEGDAVPSVGAIEF
NKVNYLCRVGRAIYAERVRLWDSNTGKLSDFSTHFSFIIDTRGATNYGHGLAFFLAPVGF
QIPPNSDGGFLGLFNTTTSFSSQNQIIAVEFDSYSNEEWDPPFEHVGINNNSIASVTSTR
WNASFHSGDTADTWITYNATTKNLTVFWSYEANPNSPFAWCIEILNSAMSMLDTNFNTKL
GDFGLARLVDHAQGRYTTGLAGTFGYMAPECIRTGKASKESDIFSFGVVALEIACGRRAV
EPEMDERQVVLVPWVWELYGKESLVDPVDQRLCGDFDGKQIERLMIVGLWCAHPDHTLRP
SIRQAMQVLNFEVGMPNLPMKMPVATYIYEPNSWICTTSEPSMTFSGANVGR
Download sequence
Identical sequences 29760.GSVIVG00004033001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]