SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00004137001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29760.GSVIVG00004137001
Domain Number - Region: 333-365
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0103
Family Chicken cartilage matrix protein 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00004137001
Sequence length 378
Comment (Vitis vinifera)
Sequence
MSLARRYAFGFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGI
TNAVNVGIAVQADWENREFISHISLNIRRLFEFLVQFEATTKSKLASLNEKLDTLERRLE
LLEVQVGTASSNPSLFAT
Download sequence
Identical sequences 29760.GSVIVG00004137001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]