SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00005438001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00005438001
Domain Number 1 Region: 43-151
Classification Level Classification E-value
Superfamily HSP20-like chaperones 7.63e-39
Family HSP20 0.0000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00005438001
Sequence length 163
Comment (Vitis vinifera)
Sequence
MRGGKRMTSLVPWRGGGLDHWIGSPFSSELWDPLGFGSRDWRRGRDDDVSAVALASVDWR
ETDNAHTIRADLPGVRKEDVKVQVEDGNILQISGEKTKEKEESGERWHRIERQRGSFLRR
FRLPENANTEGINCALENGVLTVTVPKKEATSTGSDVKQIDIG
Download sequence
Identical sequences D7TFQ9
29760.GSVIVG00005438001 GSVIVT01013663001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]