SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00007548001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00007548001
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily SRF-like 4.19e-30
Family SRF-like 0.00025
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00007548001
Domain Number - Region: 129-172
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0129
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00007548001
Sequence length 259
Comment (Vitis vinifera)
Sequence
MARQKIQIKKIDNTAARQVTFSKRRRGLFKKAQELSTLCDAEIALIVFSAAGKLFEYSSS
SVSQVIERHNQHPQTPEKPEPPSLELQLENSTCAALSKEIAQQTQRLRQMKGEELQGLKI
EELIELEELLEAGLCSVVEEKAERIRTEISDLQRKGDLLREENERLRKEVENISEAPLLQ
QGHSSESITTNICSLSDPNQGLHNSDTSLKLGVEKLQSNWEGPYVVTKAEDLGAYHIQTL
NKVSLLRPWNVTNLKQYYQ
Download sequence
Identical sequences 29760.GSVIVG00007548001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]