SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00008269001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00008269001
Domain Number 1 Region: 75-174
Classification Level Classification E-value
Superfamily Histone-fold 2e-35
Family Nucleosome core histones 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00008269001
Sequence length 195
Comment (Vitis vinifera)
Sequence
MGIVWGEKQKNGKKGVRERKSLFLAGEGESWENKKKWEKEKILEKAKTELSRELSGCQRK
EGWWSQEKPVSCLVKAGLQFPVSRIDRYLKKGCYSQRVGTGASVYLATVLEYLATEVLEL
ARNAAWDNQKHRIIPRHVLLAVRNDEELGKLLAGVTIARGGVLPNINHILLPKKTDKAGK
ESKSPSKATKSPRKA
Download sequence
Identical sequences 29760.GSVIVG00008269001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]