SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00009837001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00009837001
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily POZ domain 5.5e-24
Family Tetramerization domain of potassium channels 0.0052
Further Details:      
 
Domain Number 2 Region: 120-250
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000000173
Family DPP6 N-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00009837001
Sequence length 257
Comment (Vitis vinifera)
Sequence
MGIQKDRIRLNVGGKIFETTVTTLANAGRNSLFGAMFDDNWNFQFNNSDEYFIDRNPDCF
AVLLDLLRTGELCIPANIPEKLLCREALFYGLLDHIRSAKWGQFDGNRLRHSKSVMGRAP
GDGTAIRAGPDGGCCVAHGSMVHVYDWMLEEHPPIHLDYQRVNDVGWIDPGNIVISACER
LGRGDGGMGLFSSSTGELRSKFQVTHDNQVKSYTAGALGFSSDYRIFASCKGRSNEYGIG
VWDQITGKQIDFFYEPS
Download sequence
Identical sequences 29760.GSVIVG00009837001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]