SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00009976001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00009976001
Domain Number 1 Region: 14-71
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000432
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 
Domain Number 2 Region: 100-186
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000609
Family Protein kinases, catalytic subunit 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00009976001
Sequence length 200
Comment (Vitis vinifera)
Sequence
MTDNKDYQPLPFQSQLLDTGNLVLVQNDGKRVVWQGFDYPTDTMLPYMKLGLDRRTGLNR
FLTSWKSPDDPGTGEYSCKMEVGGSPQLLLSKGSERIWRSGLLPAIGYMSPEYAMEGLFS
IKSDVYSFGVLLLEIITRRRNTTYYCDSPFFNLVGYVWSLWNEGKALDVVDVSLIKSNHA
NEGLRSIQIGLLCVQEFAID
Download sequence
Identical sequences 29760.GSVIVG00009976001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]