SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00010301001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00010301001
Domain Number 1 Region: 22-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-64
Family Calnexin/calreticulin 0.0000573
Further Details:      
 
Domain Number 2 Region: 209-322
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.88e-35
Family P-domain of calnexin/calreticulin 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00010301001
Sequence length 442
Comment (Vitis vinifera)
Sequence
MPVIRLQPPLKLLLLILVFYFRYSDSEIIFEERFEDGWQSRWVVSDWKRSEGKAGLFKHT
AGKWSGDPDDKGIQTYKDAKHFAISAKIPEFNNKNRTLVVQYSIKFEQDIECGGGYIKLH
SGYVNQKKYGGDTPYSLMFGPDICGTQQKKLHVIVSYQGQNYPIKKEIQCETDKLTHFYT
FILRPDATYTVLVDNREREFGSLYTDWDILPPRKIKGDSRKPADWDDREYIDDPNDVKPV
GYDSIPAEIPDPKAKEPDDWDEEEDGLWRRPKIPNPAYKGPWKRKKIKNPNYKGKWKTPW
IDNPEFEDDPDLYVLKPIKYIGIEVWQVKAGSVFDNILICDDPEYARQVVEDVWGKNREA
EKEAFEEAEKVRRAREEKEAERTREESEKRKAARDSRYGARKRRRRVLYLISFLLFVSLM
KPAIINPFPGCCFRFIIALIQI
Download sequence
Identical sequences 29760.GSVIVG00010301001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]