SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00014362001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00014362001
Domain Number 1 Region: 79-154
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.44e-32
Family Skp1 dimerisation domain-like 0.0000248
Further Details:      
 
Domain Number 2 Region: 5-67
Classification Level Classification E-value
Superfamily POZ domain 6.28e-22
Family BTB/POZ domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00014362001
Sequence length 156
Comment (Vitis vinifera)
Sequence
MSSSRKITLKSSDGEAFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC
KKHVEAPKPEERSGVDEELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A0A172MAC8 A5BBC4
XP_002270061.1.54126 29760.GSVIVG00014362001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]