SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00014468001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00014468001
Domain Number 1 Region: 4-79
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0000000238
Family PhyH-like 0.038
Further Details:      
 
Domain Number 2 Region: 82-125
Classification Level Classification E-value
Superfamily POZ domain 0.000000392
Family BTB/POZ domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00014468001
Sequence length 176
Comment (Vitis vinifera)
Sequence
MGISGKLSPEQLHSFHSQGFLVIELFSSPEEIDAMRRRMDQLLDDFDCSTAASIFSTKNQ
QKLTDDYFYKSAEKISFFFLRRKHFGVLLENMKCSNVVFDVTGKSFHAYKLVLAARSLVF
RNEFFLLDLILLTFVIHRACGFGMHSFLLSMLIAVQVDLSMTRRLQVKLKVVFHAH
Download sequence
Identical sequences 29760.GSVIVG00014468001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]