SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00015027001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00015027001
Domain Number 1 Region: 171-261
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 414-497
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 39-100
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 4 Region: 323-395
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 5 Region: 592-662
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000804
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00015027001
Sequence length 667
Comment (Vitis vinifera)
Sequence
MSFSLTPSKRSYERSLTDSNGKGKWQKSGGFYSQNQSLKISPGTVVFRVLCPASKTGSVI
GKGGTIISQIRQETGVKVRVEETVSGCDERVVLITGSDKDTEADNEQSKEDGEDTKAAEE
VSDTKEPGENDEDKESVPVEDSQVEKGISSVQKALLLVFERMAEGESETNGGDEDSNKSP
TFVVRLLVLSSQVGCLLGKGGSVIKQMSAESGAQIRILPRDKLPLCASPSDELVQITGEL
DACKQALQSISQQLLENPPRDYDIVSTNPTGSSSHLFGPPLPRSEAQPPPNYSFPAQGAP
YAAGVRDTDYHSNTPQLHKFHESGMPGWMKPQDILTFRLLCHDERVGGIIGKGGTIIKNL
QNETGCEIKVLDGVPDSEDRVIFISGSAHPDDRISPAQDAVLRVQSRIVRAIPDSKEKTV
IARLLVSSTQIGCLLGKGGAIIAEMRKLSGAHIRILGKDQIPKCASENEEVVQINGEFEA
VQEALLQITTRLRHHHFRDAFSVNHPSNPAFTDQVPPFPPYLARREFSPPGMYSNLGPSF
HKFDAVGPSSAPWGHQGLIEGGVPIGLADFAGGPQRRIPGFGGGNQQAIITSTTVEVVVP
RSLVPSIYGEDGGCLRQIRQISDAKITITEPKPGASETVIIISGTPEQTHAAQSLIQAFV
LSETESP
Download sequence
Identical sequences 29760.GSVIVG00015027001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]