SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00018349001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00018349001
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.95e-35
Family HSP20 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00018349001
Sequence length 108
Comment (Vitis vinifera)
Sequence
MRVDWKETLVAHVFNADLPGLKKEEVKVEVEEGRVLQINRERSKEQEEKNDKWHLMERSS
GKFLRRFRLLEDAKTDEVKANMENGVMSVTVPKEEVKKAEVKAIEIFG
Download sequence
Identical sequences F6HNQ0
29760.GSVIVG00018349001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]