SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00019338001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00019338001
Domain Number 1 Region: 19-106
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000116
Family Alginate lyase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00019338001
Sequence length 120
Comment (Vitis vinifera)
Sequence
MVDPTDGFTPVPLHQSNFEVQKPYDVPQNQRYSHINGVHKLWVYSTDKAHTTTSHTASRT
EIRIRGYDYSSCVWQYEGHGYVPSGTTGVSIMQVFGATNRATTLMVRFMMVHSPTTEVQC
Download sequence
Identical sequences D7SWA9
29760.GSVIVG00019338001 GSVIVT01022288001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]